KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0012Help
Entry
Rsph17025_0012    CDS       T00512                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
Ethylmalonyl pathway
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rsph17025_0012
   00630 Glyoxylate and dicarboxylate metabolism
    Rsph17025_0012
   00640 Propanoate metabolism
    Rsph17025_0012
   00650 Butanoate metabolism
    Rsph17025_0012
  Lipid metabolism
   00071 Fatty acid degradation
    Rsph17025_0012
   00072 Synthesis and degradation of ketone bodies
    Rsph17025_0012
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rsph17025_0012
   00310 Lysine degradation
    Rsph17025_0012
   00380 Tryptophan metabolism
    Rsph17025_0012
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rsph17025_0012
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rsph17025_0012
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rsph17025_0012
Enzymes [BR:rsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rsph17025_0012
Exosome [BR:rsq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17025_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
13543..14712
Genome map
AA seq 389 aa AA seqDB search
MSDILILSAVRTAIGGFGGALAAVPPGDLATTVTRAALERAGVEPDRVGHVVFGHVINTE
PRDMYLSRVAAMQAGIPSGVPAMNVNRLCGSGVQAIVSAMQALMLGDAEVALAGGAESMS
RAPYVLASARWGQKMGDTRALDMMTGALNCPFGTGHMGITAEIVAERHGISREDQDAFAL
ESQTRAARAQEEGRFDGQIAPVEIASRKGPVSFARDEHPKATTAEALAGLRPAFQKGGTV
TAGNASGINDGAGALVLAREGAVPGARPLGRLIGYAHAGVDPEVMGLGPIPAVQALCART
GLSVADFDVIESNEAFAAQALAVSRALDFDPAKVNPNGGAIALGHPVGATGAIITVKALH
ELHRTGGRRALVTMCIGGGQGIALALERV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcctcatcctctccgccgtgcggaccgccatcggcggcttcggcggcgcg
ctcgccgccgtgccaccgggcgatctcgccaccaccgtcacccgcgccgcgctggagcgc
gcgggggtcgagccggaccgcgtcggtcatgtggtcttcggccatgtgatcaacaccgag
ccgcgcgacatgtatctctcgcgcgtggcggcgatgcaggcgggcatcccctcgggcgtg
ccggcaatgaacgtgaaccggctctgcggctcgggcgtgcaggccattgtctcggccatg
caggcgctgatgctgggcgatgccgaggtggcgctggcgggcggggcggaatcgatgagc
cgcgcgccctacgtgctggcctcggcccgctggggacagaagatgggcgacacgcgcgcg
ctcgacatgatgacgggggcgctgaactgccccttcggcaccggccacatgggcatcacc
gccgagatcgtggccgagcggcacggcatcagccgcgaggatcaggacgccttcgcgctg
gaaagccagacccgtgccgcgcgcgcgcaggaggaggggcggtttgacggccagatcgcc
ccggtggagatcgcctcccgcaaggggccggtttccttcgcgcgggacgaacatcccaag
gccaccacggccgaggcgctggcgggtctgcgccccgccttccagaagggcggcaccgtg
acggccggcaatgcgagcggcatcaacgatggggccggcgcgctggtgctggcgcgcgag
ggggcggtgcccggcgcgcgtccgctcggccggctcatcggctatgcccatgcgggtgtc
gatcccgaggtgatggggctgggaccgatcccggcggtgcaggcgctctgcgcacgcacg
ggcctctcggtcgcggacttcgacgtgatcgagtcgaacgaggcctttgccgcgcaggcg
ctggcggtgagccgcgcgctcgacttcgatccggcgaaggtcaatccgaacggtggcgcc
atcgcgctcggccatccggtcggcgccacgggggcgatcatcacggtgaaggcgctgcac
gagctgcaccgcaccggcgggcgtcgcgcgcttgtcaccatgtgcatcggcggcgggcag
gggatcgcgctggcgctggaacgggtctga

DBGET integrated database retrieval system