KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0026Help
Entry
Rsph17025_0026    CDS       T00512                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rsph17025_0026
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Rsph17025_0026
    3.5.1.-  
     Rsph17025_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(34628..35233)
Genome map
AA seq 201 aa AA seqDB search
MRPLTEALIVIDVQNDFCPGGALAVAGGDAIIPRINALLPEFGARIFTQDWHPADHSSFA
ANHGAEPFSLVEMPYGPQVLWPTHCVQGTTGAEFHPALDTDPAELILRKGFRAGIDSYSA
FFENDRTTPTGLEGYLRSRGIEAVTLVGLATDFCVAYSALDAARLGFRATVLEGACAAID
LNGSLAAIKAQMAAAGVRLEA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccctgaccgaagccctcatcgtcatcgacgtgcagaacgacttctgcccgggc
ggggcgcttgccgtcgccggaggcgatgcgatcatcccccgcatcaacgcgctcctgccg
gagttcggcgcgcggatcttcacgcaggactggcacccggccgatcattcctcctttgcc
gccaaccacggcgccgagcccttctcgctggtcgagatgccctacggtccgcaggtgctc
tggcccacccattgcgtgcagggcacgacgggggccgagtttcacccggcgctggacacc
gaccccgccgaactcatcctccgcaaggggtttcgcgcaggcatcgacagctattcggcc
tttttcgagaacgaccggaccacgcccaccgggctcgagggctacctgcgcagccgcggg
atcgaggccgtgacgctcgtgggcctcgccaccgatttctgcgtggcctattccgcgctc
gacgcggcgcggctgggcttccgcgcgacggtgctcgagggcgcctgcgccgccatcgac
ctcaacggctcgcttgccgcgatcaaggcgcagatggccgcggccggcgtccggctggag
gcctga

DBGET integrated database retrieval system