KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0076Help
Entry
Rsph17025_0076    CDS       T00512                                 

Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17025_0076
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsph17025_0076
  Amino acid metabolism
   00310 Lysine degradation
    Rsph17025_0076
Enzymes [BR:rsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rsph17025_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(82782..84302)
Genome map
AA seq 506 aa AA seqDB search
MGTEVRVPTLGESVSEATVATWFKKPGDRVAADEMLCELETDKVTVEVHAPVAGRLTEIV
APEGTTVAVSALLAQIGAAEAGDEPAPARTHGGAEAQAGAGESKMIDVMVPALGESVSEA
TVSTWFKKPGDTVAQDEMLCELETDKVSVEVPAPAAGVLAEILVTEGTTVAAGSRLALIS
TDGQGVAAAPKAEAPKVDAAPARAAKKDVEDAPAAKKAMAEAGLSPDAVQGTGRDGRIMK
DDVARAVAGASQAQAPAPAPQPSLPRQPVPADDAAREERVKMTRLRQTIARRLKEAQNTA
AMLTTYNEVDMSGVMALRNEYKDQFEKKHGTKMGFMSFFVKACCHALKEVPEVNAEIDGT
DIVYKNYVHMGVAVGTPSGLVVPVVRDADQMGFAQIEKKIAELGARARDGKLSMAEMQGG
SFTISNGGVYGSLMSSPILNPPQSGILGMHKIQDRPVVEKGQIVIRPMMYLALSYDHRIV
DGKGAVTFLVRVKEALEDPRRLLLDL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgggaacggaagttagggttccgacgctgggagaaagcgtctcggaggcgacggtcgcc
acctggttcaagaagccgggggaccgtgtggccgccgacgagatgctctgcgagctcgag
accgacaaggtgacggtcgaggttcacgcgcccgtcgcgggccgcctgaccgagatcgtc
gcccccgaggggacgacggttgcggtttcggcccttctggcgcagatcggagcagcggag
gccggcgacgaaccggccccggcaaggactcatgggggcgccgaggcacaggccggcgcg
ggagagagcaagatgatcgacgtgatggtgcctgcccttggcgaatcggtgtccgaggcg
accgtgtccacctggttcaagaagccgggcgacacggtggcgcaggacgagatgctctgc
gagctcgagaccgacaaggtgtcggtcgaggtgcccgcgcccgcggcgggcgtgctggcc
gagatcctcgtgaccgagggcacgaccgtcgccgcgggttcgcgccttgcgctgatctcg
accgatggccagggcgtggccgccgctccgaaggccgaggcgccgaaggttgacgcagcc
cccgccagggccgcgaagaaggacgtcgaggatgctccggccgcgaagaaggcgatggcc
gaggccggcctttcgccggatgcggtgcagggcaccggccgcgatggccggatcatgaag
gacgacgtcgcccgtgcggtcgcgggcgcatcgcaggctcaggccccggcacccgcgccg
cagccctcgctgccgcgccagccggtcccggccgacgatgcggcccgcgaggagcgggtc
aagatgacccgcctgcgccagaccatcgcccgccgcctgaaggaggcgcagaacaccgcc
gccatgctcaccacctacaacgaggtggacatgtcgggcgtcatggcgctgcgcaacgaa
tacaaggaccagttcgagaagaagcacggcaccaagatgggcttcatgtccttcttcgtg
aaggcctgctgccacgcgctcaaggaagtgcccgaggtcaatgcggagatcgacggcacc
gacatcgtctacaagaactacgtccacatgggcgtggcggtgggcacgccctcgggcctc
gtggtgccggtggtgcgcgacgccgaccagatgggctttgcccagatcgagaagaagatc
gccgagcttggcgcgcgggcgcgtgacggcaagctctcgatggccgagatgcagggcggc
agcttcaccatctcgaacggcggcgtctatggctcgctcatgtcctcgccgatcctgaac
ccgcctcagtcgggcatcctcggcatgcacaagatccaggaccggccggtggtggaaaag
ggccagatcgtcatccgcccgatgatgtatctcgcgctcagctacgatcaccgcatcgtc
gatggcaagggcgcggtgaccttcctcgtccgcgtcaaggaggcgctggaagatccgcgc
cgcctgctgctcgacctctga

DBGET integrated database retrieval system