KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0087Help
Entry
Rsph17025_0087    CDS       T00512                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17025_0087
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsph17025_0087
   00650 Butanoate metabolism
    Rsph17025_0087
  Energy metabolism
   00190 Oxidative phosphorylation
    Rsph17025_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
94887..95258
Genome map
AA seq 123 aa AA seqDB search
MRFITARKRAEGMGAAHHGTDRHWYMIVSAVGLAVLIPIFVYVVGNAIGEGRERVLEIFS
HPFNAILSGLVLFFGMRHFAEGSTMMIEDYWQGVPRRLLVICAQSFAYGVAAIGLFALAK
IAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcatcaccgcccgcaagcgcgccgagggcatgggcgccgcccaccacggcacc
gaccgccactggtacatgatcgtctcggcggtgggtctcgcggtcctgatcccgatcttc
gtctatgtcgtcggcaatgccatcggcgaaggccgtgagcgcgtgctcgagatcttctcg
catccgttcaacgcgatcctgtcgggactggtgctgttcttcggcatgcgccacttcgcc
gaaggttcgaccatgatgatcgaggactactggcagggcgtgccgcgccgcctgctggtg
atctgcgcgcaatccttcgcctatggcgtggcggcgatcgggctgttcgccctcgccaag
atcgccctctga

DBGET integrated database retrieval system