KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0087Help
Entry
Rsph17025_0087    CDS       T00512                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00020  Citrate cycle (TCA cycle)
rsq00190  Oxidative phosphorylation
rsq00650  Butanoate metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01200  Carbon metabolism
Module
rsq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rsq_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsph17025_0087
   00650 Butanoate metabolism
    Rsph17025_0087
  Energy metabolism
   00190 Oxidative phosphorylation
    Rsph17025_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABP68998
JGI: Rsph170250087
UniProt: A4WNN4
Position
94887..95258
Genome map
AA seq 123 aa AA seqDB search
MRFITARKRAEGMGAAHHGTDRHWYMIVSAVGLAVLIPIFVYVVGNAIGEGRERVLEIFS
HPFNAILSGLVLFFGMRHFAEGSTMMIEDYWQGVPRRLLVICAQSFAYGVAAIGLFALAK
IAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcatcaccgcccgcaagcgcgccgagggcatgggcgccgcccaccacggcacc
gaccgccactggtacatgatcgtctcggcggtgggtctcgcggtcctgatcccgatcttc
gtctatgtcgtcggcaatgccatcggcgaaggccgtgagcgcgtgctcgagatcttctcg
catccgttcaacgcgatcctgtcgggactggtgctgttcttcggcatgcgccacttcgcc
gaaggttcgaccatgatgatcgaggactactggcagggcgtgccgcgccgcctgctggtg
atctgcgcgcaatccttcgcctatggcgtggcggcgatcgggctgttcgccctcgccaag
atcgccctctga

DBGET integrated database retrieval system