KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0276Help
Entry
Rsph17025_0276    CDS       T00512                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00240  Pyrimidine metabolism
rsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rsph17025_0276
Enzymes [BR:rsq01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Rsph17025_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N TMP_2
Motif
Other DBs
NCBI-ProteinID: ABP69186
JGI: Rsph170250276
UniProt: A4WP72
Position
269979..271286
Genome map
AA seq 435 aa AA seqDB search
MDARSINARLRRGEVPSAAELGWFAQGLASGHVTDAQAGAFAMAVCLQGLGEEGRVALTR
AMRDSGRVLEWDLPGPVLDKHSTGGIGDCTSLLLAPALAACGAYVPMISGRGLGHTGGTL
DKLESIPGFRVALGEDRLRGQIEDVRCAIVAADESMAPADRRLYLIRDVTGTVESIDLIT
ASILSKKLAAGLEGLVLDVKVGSGAFMKSMDEAEALARALVGTAQGAGCMTSALITDMSQ
PLATAAGNALEVIEVMETLTGTSINAALWDVTVALGGEALALGGLAADAEDGAHRIEQAL
ESGHAAEYFARMVAAQGGPVDFVERWPDRLPSAPVMREVPSLRTGFVLRIDTAALGQAVV
RLGGGRLRETDRVNPSVGLADIAGIGEEVSEDLPLAMVHAATEADAEAAISAIQAAYVIS
DQEPAEPPLIHARIA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
gtggacgcgcgttcgatcaacgccaggctgcgccgcggcgaggtgccctcggcggccgaa
ctcggctggttcgcgcaggggcttgcctcgggccatgtcaccgacgcgcaggccggcgcc
ttcgccatggcggtctgcctgcaaggcctgggcgaggaggggcgcgtggcgctcacccgc
gccatgcgcgactcgggccgggtgctcgaatgggacctgccggggccggtgctcgacaag
cactcgacaggcgggatcggcgactgcacctcgctgctgctggcgcccgcgctcgccgcc
tgcggggcctatgtgccgatgatctcgggccgggggctcggccacaccggcggcacgctg
gacaagctcgagtcgatcccgggctttcgggtcgctcttggggaggaccgcctgcgcggg
cagatcgaggatgtgcgctgcgccatcgtcgccgccgacgagagcatggccccggcggac
cggcggctctacctgatccgcgacgtgaccggcacggtcgagtcgatcgacctcatcacg
gcgtccatcctgtccaagaagctcgcggccgggctcgaggggctggtgctcgatgtgaag
gtggggtcgggtgccttcatgaagtcgatggacgaggcggaggcgctggcgcgtgccctg
gtgggcacggcgcagggggcgggctgcatgacctcggcgctcatcaccgacatgagccag
ccgctcgccaccgcggcgggcaacgcgctcgaagtgatcgaggtgatggagaccctgacc
ggaacctcgatcaacgcggccctctgggatgtgacggtggcgctgggcggcgaggcgctg
gcgctgggcgggctggcggccgacgccgaggatggcgcgcaccggatcgagcaggcgctg
gaaagcggccacgccgccgaatatttcgcccgcatggtggcggcgcagggcgggcccgtc
gatttcgtcgagcgatggcccgaccggctgccctcggccccggtaatgcgcgaggtgccc
agcctgcgcacggggttcgtgctgcggatcgacacggcggcgctgggccaggcggtcgtg
cggctcggcgggggcaggctgcgtgaaaccgatcgggtgaatccctcggtgggcctcgcc
gacattgcggggatcggcgaggaagtgtccgaggacctgccgctcgcgatggtccatgcc
gccaccgaagcggatgccgaggcggcgatctcggcgattcaggcggcctatgtgatctcg
gatcaggagccggccgaaccgccgctcattcatgcgaggatcgcctga

DBGET integrated database retrieval system