KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0342Help
Entry
Rsph17025_0342    CDS       T00512                                 

Definition
cytochrome P450
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Rsph17025_0342
  Amino acid metabolism
   00380 Tryptophan metabolism
    Rsph17025_0342
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rsph17025_0342
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Rsph17025_0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(335399..336622)
Genome map
AA seq 407 aa AA seqDB search
MARLRRQRGTLARPMKTLSQSPHDRRFLRDPYRFYRQARTAGPFFRWEELDVICTTSYAA
ANAILRDRRFGREVPAERRAPVPAHLAPFAAVAEHSMLELEPPRHTRLRNLVLRAFTTRR
LGSMQPQIARLAHGLIDDMPGGPFDLLPAFSQRLPITLIARLIGIPETLAPELLRWSSAM
VAMYQAGRNRQTEERAAEAAAAFSDFLRLHIADRRDRPADDLLTHLIAAEADGQQLSTDE
IVSTCILILNAGHEAAVHAIGNAVATLLQHRTPPEALGPARIAATVEEMLRFDPPLHLFR
RIAYAPVEIMGQTFAEGEEVALLLAAANRDPGPWERPDRFLWNRPEKPHLAFGAGLHFCL
GAALARLELAMAVPILFTRLPGLHLVKPPRWSDSWHFRGLERLIVAP
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggctccgccgacagcgcggaacccttgcccggccgatgaagaccctgagccaa
tcgccccacgaccgacgcttcctccgcgatccctaccgcttctaccggcaggcgcgcacg
gccgggccgttcttccggtgggaagagctcgatgtcatctgcaccacctcatacgccgcg
gccaatgcgatcctgcgcgaccggcgattcggccgcgaggttccggcggagcgacgcgcc
ccggtgcccgcgcatctggccccgttcgcggccgtggccgagcattcaatgctggagctc
gagccgccgcgccacacgcggctgcgcaacctcgtgctccgcgccttcaccacgcggcgg
ctcggctcgatgcagccccagatcgcccggctggcacacgggctcatcgacgatatgccg
ggcgggccgttcgacctgctgccggccttcagccagcgcctgcccatcaccctcatcgcg
cggctgatcggcattcccgagacgctcgcccccgagcttctgcgctggtcctcggcgatg
gtcgccatgtatcaggcggggcggaaccgccagacggaagagcgcgccgcagaggccgcc
gccgccttctcggacttcctgaggcttcacatcgcggatcgccgcgatcggcccgccgac
gacctgctgacacacctgatcgcggccgaagccgacggccagcaactctcgaccgacgaa
atcgtctcgacctgcatcctgatcctgaacgcaggccacgaggcggcagtccatgcgatc
ggcaacgcggtggcgacgctccttcagcatcggacgccgcccgaggcgctcgggccggcc
cgtatcgcggccaccgtcgaggagatgctccggttcgatccgcccctgcatctcttccgg
cgcatcgcctacgcgccggtcgagatcatgggccagacctttgccgaaggcgaggaggtg
gcgctgctcctggcggccgccaaccgcgatcccggcccgtgggagcgaccggaccgcttc
ctctggaaccggcccgagaagccccatctcgccttcggagccggcctgcacttctgcctg
ggcgcggcgcttgcgcggctcgagctggccatggccgtgcccatcctcttcacccgtctg
ccggggctgcacctcgtcaagccgccgcgctggtcggacagctggcatttccgcgggctc
gagcggctgatcgtggcgccctga

DBGET integrated database retrieval system