KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0343Help
Entry
Rsph17025_0343    CDS       T00512                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17025_0343
   01230 Biosynthesis of amino acids
    Rsph17025_0343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17025_0343
   00051 Fructose and mannose metabolism
    Rsph17025_0343
   00562 Inositol phosphate metabolism
    Rsph17025_0343
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17025_0343
Enzymes [BR:rsq01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rsph17025_0343
Exosome [BR:rsq04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rsph17025_0343
  Exosomal proteins of bladder cancer cells
   Rsph17025_0343
  Exosomal proteins of melanoma cells
   Rsph17025_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(336878..337615)
Genome map
AA seq 245 aa AA seqDB search
MRKLAAGNWKMNGTEADLAEIDALMAAHPAPHCEMLICPPATLLSRMAARATSDLMVGGQ
DCHPKVSGAHTGDISAAMLADAGASHVILGHSERRADHGESDSLVRLKAEAAHAAGLVAI
ICVGETEAQRDAGQTLDVIGAQLAGSVPDGATALRTVIAYEPVWAIGTGRTPTTAEIAEV
HGFLRARLAERFADASGFRLLYGGSVKPSNAAEIFAVPNVDGALVGGASLKAADFGGIVA
ALSAA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagcttgcagcggggaactggaagatgaacggaaccgaggccgatctcgcagag
atcgatgccctgatggccgcccatccggcgccgcactgcgagatgctgatctgcccgccc
gcgacgctgctgtcccgcatggcggcgcgcgcgacgtcggacctgatggtcggcggtcag
gactgccaccccaaggtctcgggcgcccataccggcgacatttccgccgccatgctggcc
gatgccggggccagccatgtgatcctcggccattcggagcgccgggcggaccacggcgag
agcgactcgctcgtcaggctcaaggccgaggcggcccatgccgcggggctcgtggcgatc
atctgcgtgggcgagaccgaggcgcagcgcgacgcgggccagacgctcgacgtgatcggg
gcgcaactcgcgggctcggtgccggacggcgccacggccctccggaccgtgatcgcctat
gagccggtctgggcgatcggcaccgggcgcacgcccacgaccgccgagattgccgaagtc
cacggcttcctgcgcgcccgtctggccgagcgtttcgcggatgcgagcggcttccgcctg
ctctacggcggctcggtgaaaccctcgaacgcggccgagatcttcgcggtgccgaacgtg
gacggggcgctcgtcggcggcgcaagcctcaaggccgcggatttcggcggcatcgtcgcc
gccctctcggccgcctga

DBGET integrated database retrieval system