KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0349Help
Entry
Rsph17025_0349    CDS       T00512                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17025_0349 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17025_0349 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17025_0349 (trpA)
Enzymes [BR:rsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rsph17025_0349 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
344766..345557
Genome map
AA seq 263 aa AA seqDB search
MTRIDDTFRRLRAEGKKAFVAYIMAGDPDLETSLEVMKGLPGAGVDIIELGMPFTDPMAD
GPTIQTAGQRALEGGQTLARTLAMVREFRRGDASTPIVMMGYYNPIHARGVDRFLAEAQE
AGIDGLIVVDLPPEEDAELCLPAQAAGLNFIRLATPTTDDRRLPKVLQNTSGFVYYVSIT
GITGAAAAQAVDVAPEVARLKAATDLPVIVGFGITSPEAARDIAGVADGCVVGSAIVKLV
AEGRPVAEVLDRVAALAAGAHAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatgacaccttccggcggcttcgggccgaggggaagaaggccttcgtg
gcctatatcatggcgggcgatcccgatctcgagacctcgctcgaggtgatgaagggcctg
cccggcgcgggcgtggacatcatcgagctgggcatgccctttaccgatccgatggcggac
gggccgacgatccagacggcggggcagcgcgcgctcgagggtgggcagacgctggcaagg
acgctcgcgatggtgcgggagttccgcaggggcgatgcttcgacgcccatcgtcatgatg
ggatactacaacccgatccatgcgcgcggcgtggaccgctttctggccgaggcgcaggag
gccgggatcgacgggctgatcgtggtggacctgccgcccgaggaggatgccgaactgtgc
ctgcccgctcaggcggcggggctgaacttcatccggctggccactcccacgaccgacgac
cgccgcctgcccaaggtgctgcagaacacgtcgggcttcgtctattacgtctcgatcacc
gggatcaccggggcggccgcagcgcaggcggtggatgtggcgcccgaggtcgcgcggctg
aaggcggcgacggacctgccggtgatcgtgggattcggcatcacctcgcccgaggcggcg
cgggacatcgcgggcgtggccgacggctgcgtggtcggctcggcgatcgtgaagctcgtg
gcggagggccgtccggtcgcggaggtgctggaccgggtggcggcgctggcggccggcgct
cacgccgcctga

DBGET integrated database retrieval system