KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0349Help
Entry
Rsph17025_0349    CDS       T00512                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00260  Glycine, serine and threonine metabolism
rsq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01130  Biosynthesis of antibiotics
rsq01230  Biosynthesis of amino acids
Module
rsq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17025_0349
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17025_0349
Enzymes [BR:rsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rsph17025_0349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA PcrB His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABP69255
JGI: Rsph170250349
UniProt: A4WPE1
Position
344766..345557
Genome map
AA seq 263 aa AA seqDB search
MTRIDDTFRRLRAEGKKAFVAYIMAGDPDLETSLEVMKGLPGAGVDIIELGMPFTDPMAD
GPTIQTAGQRALEGGQTLARTLAMVREFRRGDASTPIVMMGYYNPIHARGVDRFLAEAQE
AGIDGLIVVDLPPEEDAELCLPAQAAGLNFIRLATPTTDDRRLPKVLQNTSGFVYYVSIT
GITGAAAAQAVDVAPEVARLKAATDLPVIVGFGITSPEAARDIAGVADGCVVGSAIVKLV
AEGRPVAEVLDRVAALAAGAHAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatgacaccttccggcggcttcgggccgaggggaagaaggccttcgtg
gcctatatcatggcgggcgatcccgatctcgagacctcgctcgaggtgatgaagggcctg
cccggcgcgggcgtggacatcatcgagctgggcatgccctttaccgatccgatggcggac
gggccgacgatccagacggcggggcagcgcgcgctcgagggtgggcagacgctggcaagg
acgctcgcgatggtgcgggagttccgcaggggcgatgcttcgacgcccatcgtcatgatg
ggatactacaacccgatccatgcgcgcggcgtggaccgctttctggccgaggcgcaggag
gccgggatcgacgggctgatcgtggtggacctgccgcccgaggaggatgccgaactgtgc
ctgcccgctcaggcggcggggctgaacttcatccggctggccactcccacgaccgacgac
cgccgcctgcccaaggtgctgcagaacacgtcgggcttcgtctattacgtctcgatcacc
gggatcaccggggcggccgcagcgcaggcggtggatgtggcgcccgaggtcgcgcggctg
aaggcggcgacggacctgccggtgatcgtgggattcggcatcacctcgcccgaggcggcg
cgggacatcgcgggcgtggccgacggctgcgtggtcggctcggcgatcgtgaagctcgtg
gcggagggccgtccggtcgcggaggtgctggaccgggtggcggcgctggcggccggcgct
cacgccgcctga

DBGET integrated database retrieval system