KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0449Help
Entry
Rsph17025_0449    CDS       T00512                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Brite
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Rsph17025_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
445783..446256
Genome map
AA seq 157 aa AA seqDB search
MARKGIVAAAAAAALAIAVPFGVKWEGTVLTPYWDRFGKVWTVCTGETAVEMRPYTMTEC
MEMHEARVGQGYARVVAAFPRLASAPPEVAAMAVDLEYNAGLGSILRAKNTSAALRDGRW
RDFCNLLPSWSKSGGSFVPGLLNRRKEAQVICLRGLR
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgtaaggggatcgttgccgcggctgcggcggcggccctcgccatcgcggtgccg
ttcggcgtgaagtgggaggggaccgtcctcacgccctattgggaccgctttggcaaagtc
tggacagtctgcacgggcgagaccgccgtcgagatgcggccttacaccatgacggaatgc
atggagatgcacgaggcgcgcgtggggcagggctacgcccgcgtggtcgcggcattcccg
cgcctcgccagcgcgccgccggaggtggcagccatggccgtggatcttgaatacaacgcc
ggtctcggctcgatcttgcgcgcgaagaacaccagcgccgccctgcgcgatggccggtgg
cgggacttctgcaacctcttgccttcttggtcgaagagcggcggcagcttcgtgccaggg
ctcctcaaccgccgcaaggaggcgcaggtgatctgccttcggggactgcgatga

DBGET integrated database retrieval system