KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0510Help
Entry
Rsph17025_0510    CDS       T00512                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00010  Glycolysis / Gluconeogenesis
rsq00620  Pyruvate metabolism
rsq00640  Propanoate metabolism
rsq00680  Methane metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17025_0510
   00620 Pyruvate metabolism
    Rsph17025_0510
   00640 Propanoate metabolism
    Rsph17025_0510
  Energy metabolism
   00680 Methane metabolism
    Rsph17025_0510
Enzymes [BR:rsq01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rsph17025_0510
Lipid biosynthesis proteins [BR:rsq01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rsph17025_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABP69416
JGI: Rsph170250510
UniProt: A4WPV2
Position
complement(508510..510471)
Genome map
AA seq 653 aa AA seqDB search
MDHAQTNAVYSASADFIAQAHVDAAGYERMYAASVSDPEAYWGEQGKRLDWIKPYTKVKN
TNFKLGEVSIKWFEDGTLNVAWNCIDRHLATRASQTAIIWEPDDPNQPAQHISYQELHDQ
VCRMANVLVSQGVRKGDRVVMYLPMIPEAAYAMLACARIGAIHSVVFAGFSPDALANRIN
DCQAKVVITADTAPRGGRRTPLKSNTDAALLHCSDRVRCLVVKHTGDQIHWMDGRDVDVK
AMMAQASPDCPIEEVGAEDPLFILYTSGSTGKPKGVVHTSGGYLTYAAMTHQLTFDYHDG
DVFWCTADVGWVTGHSYIVYGPLANGATTLMFEGVPTYPDAGRFWAVCEKHKVNQFYTAP
TAIRSLMGLGPEWVEKYDLSSLKLLGSVGEPINPEAWSWYNTHVGKGRCPIVDTFWQTET
GGHMITPLPGAIPVKPGAASKPFFGVKPVVLDPTDGHELTETATEGVLCIADSWPGQMRT
LWGDHERFEEAYFSQYKGYYFTGDGCRRDADGYYWVTGRVDDVINVSGHRMGTAEVESAL
VAHAQVAEAAVVGYPHDIKGQGIYAYVTLMNGVEPSEELRKDLVKWVRTEIGPIASPDII
QWAPGLPKTRSGKIMRRILRKIAENDFGSLGDTTTLADPSVVDDLISNRKNRG
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatcacgctcagacgaatgcggtctattccgcctcggcagatttcattgcgcaggcg
catgtcgatgccgccggctacgagcggatgtatgctgcatccgtgtccgatcccgaggcc
tactggggcgagcagggcaagcggctcgactggatcaagccctacaccaaggtcaagaac
acgaacttcaagctgggcgaggtctcgatcaagtggttcgaggacggcacgctgaacgtc
gcctggaactgcatcgaccgccatctggcgacccgcgccagccagaccgcgatcatctgg
gagccggatgatccgaaccagccggcccagcacatcagctaccaggagctgcacgatcag
gtctgccgcatggcgaacgtgctggtcagccagggcgtgcgcaagggcgaccgcgtggtg
atgtatctgccgatgatccccgaggcggcctacgcgatgctggcctgcgcgcggatcggc
gcgatccattccgtcgtcttcgcgggcttctcgccggacgcgctggcgaaccggatcaac
gactgccaggccaaggtggtgatcaccgccgacaccgcgccgcgcggcgggcggcgcacg
ccgctgaagtccaacaccgacgccgcgctgctgcactgctcggaccgggtgcgctgcctt
gtggtgaagcacaccggcgaccagatccactggatggacggccgcgacgtcgatgtgaag
gcgatgatggcgcaggcctcgcccgactgcccgatcgaggaagtcggcgccgaggatccg
ctcttcatcctctacacctcgggctcgaccggcaagccgaagggcgtcgtccacacctcg
ggcgggtatctgacctacgcggcgatgacgcatcagctgaccttcgactaccacgacggc
gacgtcttctggtgcacggcggatgtgggctgggtcaccggccacagctacatcgtctat
ggtccgctcgcgaacggtgccaccacgctgatgttcgagggcgtgccgacctacccggat
gcggggcgcttctgggcggtctgcgagaagcacaaggtcaaccagttctacaccgcgccg
acggcgatccgctcgctgatgggcctcgggccggagtgggtcgagaaatacgacctgtcg
tcgctgaagctgctcggttcggtcggcgagccgatcaacccggaagcctggagctggtac
aacacccatgtcggcaagggccgctgcccgatcgtcgataccttctggcagaccgagacc
ggcggccacatgatcacgccgctgccgggcgcgattccggtcaagccgggcgcggcctcg
aagcccttcttcggggtgaagccggtggtgctggacccgaccgacgggcacgagctgacc
gagacggcgaccgagggtgtcctttgcatcgccgacagctggccggggcagatgcgcacg
ctctggggcgaccacgagcggttcgaagaggcctatttctcgcagtacaagggctactac
ttcaccggcgacggctgccgccgcgatgcggatggctactactgggtcaccgggcgggtc
gatgacgtgatcaacgtctcgggccaccggatgggcacggccgaggtggaatcggcgctg
gtcgcccatgcccaggtcgccgaggccgcggtggtgggctatccgcacgacatcaagggt
cagggcatatacgcctatgtcacgctgatgaacggcgtggagccctccgaggagctgcgc
aaggacctggtgaagtgggtgcggaccgagatcggcccgatcgcctcgcccgacatcatc
cagtgggcgccgggcctgcccaagacccgctcgggcaagatcatgcgccgcatcctgcgc
aagatcgccgagaacgacttcggctcgctcggcgacaccacgacgctcgccgatccgtcg
gtggtggacgacctgatctccaaccgcaagaaccggggctga

DBGET integrated database retrieval system