KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0525Help
Entry
Rsph17025_0525    CDS       T00512                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rsph17025_0525
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rsph17025_0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
525688..526215
Genome map
AA seq 175 aa AA seqDB search
MFDTMTLTKAVGAGCGALLVFLLGSWAATGLYTTGGGHGEDAVQAYVIETGGGGAAEEEP
DAEAVPFAELVAAADPAAGQKVYAKCAACHKLDGSNATGPHLDGIIDRAVAGVDGFAYSD
AMVAHAADAPAWTVEELGAFVQNPRSHVPGTKMTFAGLPKEQDRADVVAYLASLQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacgatgaccctgacgaaggcggtcggcgccgggtgcggcgcgctcctggta
ttcctgctcggatcctgggcggccaccgggctctacaccaccggcgggggtcatggcgag
gatgccgtgcaggcctatgtgatcgagacgggcggaggcggggcggccgaggaagagccc
gatgccgaggccgtgcccttcgccgagctggtggccgcggccgatccggcggccggtcag
aaggtctatgcgaaatgcgcagcctgccacaagctcgacgggtcgaacgccaccggcccg
catctcgacgggatcatcgatcgcgcggtggcgggtgttgacggctttgcctattcggac
gcgatggtggcccacgcggccgatgcgccggcctggacagtcgaggaactcggcgccttc
gttcagaacccccggagccatgtgcccggcaccaagatgaccttcgcgggcctgccgaaa
gagcaggaccgggcggatgtcgtggcctatctcgcctcgcttcagtaa

DBGET integrated database retrieval system