KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0620Help
Entry
Rsph17025_0620    CDS       T00512                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17025_0620
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17025_0620
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rsph17025_0620
Enzymes [BR:rsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rsph17025_0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
617958..619343
Genome map
AA seq 461 aa AA seqDB search
MQYISTRGAAPVLGFGEAMLTGLARDGGLYVPETVPTLDEAGIAALAGLPYEEVAFRIMR
PFVGDTFGDDEFRGLIDAAYAGFGHAARAPLVQLAPNHFLLELFHGPTLAFKDFAMQLIG
QLFQAALAKTGQRITIVGATSGDTGSAAIEAFRGLSNVDVFILFPHGRVSEVQRRQMTTP
AETNVHALAVDGDFDDCQARLKDMFNDFAFRDAVGLAGVNSINWARVLAQVVYYFTAATS
LGAPHREVSFTVPTGNFGDIFAGYIARRMGLPIKRLVVATNQNDILHRALSSGDYATHGV
TPSISPSMDIQVSSNFERALFDAYGRDGAAVAALMDELKQGGFRISPNALGTLRETFTSG
RCSEEETLATIRATHAATGEVLCPHSAVGVKVAQEHLGTEPMVTLATAHPAKFPDAVEAA
TGVRPPLPARMADLFERPERMTRVPNDLAALETLIRERTGR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatatctcgactcgcggtgcggctccggttctcggcttcggcgaggccatgctg
acgggcctcgcccgcgacggcggcctctatgtgcccgagaccgtgccgacgctggacgag
gccgggatcgcggcgctggcgggcctgccttacgaggaggtggccttccgcatcatgcgc
cccttcgtcggcgacaccttcggagatgacgagttccgcggcctgatcgacgccgcctac
gcgggcttcggccatgccgcgcgcgcgcccctggtgcagctggcgccgaaccacttcctg
ctcgagctgttccacggcccgacgctcgccttcaaggatttcgccatgcagctgatcggc
cagctgttccaggcggcgctggcgaagacgggccagcgcatcaccatcgtcggcgccacc
tcgggcgacaccggatcggccgcgatcgaggccttccgggggctgtccaacgtcgatgtc
ttcatcctcttcccgcatggccgtgtgtccgaggtgcagcgccgccagatgacgacgccc
gccgagacgaacgtgcatgcgctggcggtcgatggcgatttcgacgattgccaggcccgg
ctgaaggacatgttcaacgactttgccttccgtgacgcggtggggcttgcgggcgtgaac
tcgatcaactgggcgcgggtgctggcgcaggtggtctattacttcaccgccgccaccagc
ctcggcgcgccgcaccgcgaggtgagctttaccgtgcccaccggcaatttcggcgacatc
ttcgcgggctacatcgcccggcgcatggggctgccgatcaagcggctggtggtggcgacg
aaccagaacgacatcctgcaccgggcgctgtcgtcgggcgattacgccacccatggcgtc
acgccctcgatcagcccctcgatggacattcaggtgtcctcgaacttcgagcgcgcgctg
ttcgatgcctatggccgcgacggggcggcggtggccgcgctgatggatgagctgaagcag
ggtggctttcgcatcagcccgaacgcgctgggcacgctgcgcgagaccttcacctcgggc
cgctgctctgaggaggagacgctggccaccatccgcgccacgcacgcagcgaccggcgag
gtgctctgcccgcactccgccgtaggcgtgaaggtcgcgcaggagcacctcgggaccgag
ccgatggtgacgctggccaccgcccatcccgccaagttccccgacgcggtggaggccgcc
accggcgtccgcccgccgctgcctgcccgcatggccgatctcttcgagcggcccgagcgg
atgacgcgcgtgcccaacgaccttgccgccctcgaaaccctcatccgcgaaaggaccggg
cgttga

DBGET integrated database retrieval system