KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0648Help
Entry
Rsph17025_0648    CDS       T00512                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
651816..652853
Genome map
AA seq 345 aa AA seqDB search
MHYVRPIPLADPARPEGALPLAGGPLFFDRVEILERGRTPLILPARELDPAALAPLTAPR
PPLAGLSMGRPRVMGILNVTPDSFSDGGRFAALPDALAQAQALAADGADILDIGGESTRP
GAAEVDAADEISRTAPVIEMLRGQGLSLPVSIDTRKAAVAEAALQAGADLVNDVAALTWD
VGLANLVARSGAPVCLMHAQGTPQTMQADPRYDDVLLDVYDWLAERIRAAEAAGIPRSRI
VTDPGIGFGKTLEHNLAILRRLSLFHGLGCPILLGASRKRFIGTLSGEPLADRRMGGSVA
VALAAAAQGAQILRVHDVRETRQALVLWRAVTCEAEEPARGGTQA
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcactatgtccgtccgatcccgcttgccgatccggcccggcccgagggggcgcttccg
cttgccgggggcccgctcttcttcgaccgtgtcgagatcctcgaacgcggccgcacgccg
ctgatcctgcccgcgcgggagcttgaccccgccgcgctggcgccgctgaccgcgccgcgt
ccgccgctggcgggcctctcgatggggcggccgcgggtgatgggcatcctcaacgtgacg
cccgacagcttttccgacgggggccgctttgcggccctgcccgatgcgctcgcacaggcg
caggcgctggcggccgacggggccgacatcctcgacatcggcggcgagagcacccgtccc
ggcgcggccgaggtcgatgccgccgacgagatcagccgcaccgccccggtgatcgagatg
ctgcgcgggcaggggctgtcgcttccggtctcgatcgacacgcgcaaggcggcggtcgcc
gaggcggccttgcaggccggcgccgatctggtgaacgacgtggcggccctgacgtgggac
gtgggcctcgccaatctggtcgcgcgcagcggggcgccggtctgcctcatgcatgcgcag
ggcacgccgcagaccatgcaggccgatccccgctatgacgatgtgctgctcgatgtctat
gactggcttgcggagcgtatccgcgccgccgaggccgcgggcatcccgcgatcgcggatc
gtgaccgatccgggcatcggcttcggcaagaccctcgagcacaatctggccatcctgcgc
cgcctgtcgctgttccacgggctcggctgtccgatcctgctcggcgcctcgcgcaagcgg
ttcatcggcaccctttcgggcgagcctctggccgatcggcggatggggggctccgtcgcc
gtcgcgcttgccgcagcggcgcagggcgcgcagattctccgggtgcatgacgtgcgcgag
acgcggcaggcactggttctgtggcgggcagtcacatgcgaggcggaagagcccgcgaga
ggagggacgcaagcatga

DBGET integrated database retrieval system