KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0964Help
Entry
Rsph17025_0964    CDS       T00512                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
989694..990764
Genome map
AA seq 356 aa AA seqDB search
MRRRTLLRLAAATALASPAGRLLAQEGGVLPSDHPLQTAWESWKAAFLLPAGRIVDGPQQ
NASHSEGQGYGAALAAIFGDEAALRRIVDWTETNLARRDDNLLSWRWLPGVPLAVPDENN
ATDGDLFYGWGLALAAQRFGNADLAKRATEIARAIALHCVRPHPDGSERLVLLPGATGFE
TEEGLVLNPSYYMPRAMTELAAFSGQERLARCAQDGALWIGGLGLAPDWVLVTSTGDLPA
KGLSAHSGYDAMRVPLFLLWSGLTANPALRRFIEVQREAEPGTGTPVVFDRDTGALLERS
ADPGFASVPALADCALSGRPGAAIPPFDARQPYYPATLHLMTLVAQVEGFSACAPI
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagacgtcgcacccttctccggcttgccgccgccacggcccttgcctctccggcgggg
cggctcctggctcaggagggcggtgtgctgccgtccgatcatccgcttcagaccgcctgg
gagagctggaaggcggccttcctgctgccggccggccggatcgtcgatggtccgcaacag
aatgccagccactccgaggggcagggctatggtgcggcgctggcggccatcttcggcgac
gaggcggcgctgcgccgcatcgtggactggaccgagacgaatctcgcccgccgtgacgac
aatctgctgagctggcgctggctgccgggcgtgccgctcgcggtgcccgacgagaacaac
gccaccgacggcgacctgttctacggctggggtcttgcgcttgccgcccagcggttcggc
aacgccgaccttgccaaacgcgcaaccgagatcgcccgcgccattgcgctgcactgtgtc
cgtccgcacccggatggctccgagcggctggtgctgctgccgggcgccacagggttcgag
accgaggaggggttggtgctcaacccgtcctactacatgccgcgcgccatgaccgagctt
gccgccttcagcggacaggagcggctggcccgttgcgcgcaggatggcgccctctggatt
ggcgggctcggtctcgcgccggactgggtgctggtgacgtccacgggggatctgccggcc
aagggcctgtcggcgcacagcggctatgatgcgatgcgcgtgccgctcttcctgctctgg
tccggccttacggcgaaccccgcccttcgccgcttcatcgaggtgcagcgcgaggcggaa
cccggaaccgggacccccgtcgtcttcgaccgcgacaccggcgccctgcttgagaggtcg
gcggatccgggttttgcctcggtgcccgctctggcggactgtgcgctgtccgggcggccc
ggggcggccatcccgccgtttgacgcgcggcagccctactatcccgcgacgctgcatctg
atgacgctcgtcgcacaagtggaaggtttttccgcatgcgctccgatctga

DBGET integrated database retrieval system