KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0998Help
Entry
Rsph17025_0998    CDS       T00512                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq01100  Metabolic pathways
rsq01120  Microbial metabolism in diverse environments
rsq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rsph17025_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C DUF4148 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABP69899
JGI: Rsph170250998
UniProt: A4WR85
Position
complement(1021415..1021882)
Genome map
AA seq 155 aa AA seqDB search
MKFEIKALAAIAALAAAPALAQEGDAAAGEKAFNQCQTCHVIVDDAGTTIAGRNAKTGPN
LYGVPGRQAGTREDFKGYGKDLVAAGESGLVWNEEQFTAYTKDPTAFLKEYTDNSKARGK
MTYKVRKEEDAHNIWAYLVSVSPAAEEAPAEAATN
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcgaaatcaaggctctcgcggccatcgccgcactcgccgccgccccggcgctc
gctcaggaaggcgacgccgcggccggtgagaaggccttcaaccagtgccagacctgccac
gtcatcgtggacgatgccggcaccaccatcgccgggcgcaacgccaagaccggcccgaac
ctctatggcgtgccgggccgtcaggccggcacccgtgaggatttcaaaggctacggtaag
gaccttgtcgcggcgggcgaaagcgggctggtctggaacgaagagcagttcaccgcgtac
accaaggaccccaccgccttcctgaaagagtacaccgacaactcgaaggcccgcgggaag
atgacctacaaggtccgcaaggaagaagacgcccacaacatctgggcctatctcgtgtcc
gtctcgcccgccgccgaagaggccccggccgaagccgcgaccaactga

DBGET integrated database retrieval system