KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1008Help
Entry
Rsph17025_1008    CDS       T00512                                 

Gene name
bchH
Definition
magnesium chelatase subunit H (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rsph17025_1008 (bchH)
Enzymes [BR:rsq01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rsph17025_1008 (bchH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1029762..1033343)
Genome map
AA seq 1193 aa AA seqDB search
MRGEVSGSAGVTGYNIVIVTLDAHAAGPAARIAPRLRQDFPGLTVSIHAAAEWAEKPETL
VRAKEAINSADLVIANLLFIEEHINAVLPELQAARERADAFVGMIADPQIVKLTKMGDLD
MQKPASGPMALLKKLRGSSKESGNTGESQMRMLRTIPKMLKFVPGKAQDLRAWFLAMQYW
LGGSDDNLEQMMRYLVSRYSRVREWHKVSAKAPIEYPEVGLYHPSLPNRITTDPNDLPRP
ASAKVTVGLLMLRSYILASDTAHYDAVIEAFEQKGIAVLPAFAGGLDGRPAIDAYFHDKL
GPTIDAMVSLTGFSLVGGPAYNDSHAAIEALKALDVPYIAAHPLEFQTLGQWAQAGGGLG
PVETTMLVALPEIDGATNPTVFAGRHDLAGCDGCPGGCRATAQGAETRAMAPCHERIQTL
AEKTLRLALLRRSKVAERKVGVVLYGFPPNAGAVGTAAYLGVFESLFNVLNAMKREGYQL
EVPESVQALRDAVLGGTSSQYGQPANIAAHVPAEKIVSGTPWLADIEKAWGAAPGRIQSD
GRGVYILGQNFGNVFVGIQPVFGYEGDPMRLLFEKGFAPTHAFSVFYRWLREDFHADVLL
HFGMHGALEFMPGKQAGMSGACWPDRLIGALPNVYLYAANNPSEASLAKRRTNAITVSHL
TPPLTQAGLYRGLQDLKDSLTRYRQLAPEAPEREELSLLIQEQARAVNLDMHPVETMWLK
LLETEGSLITDGLHVVGTPMTEEQIAANIALMPEMDADRRAEVENLLRQETEIPGVLRAL
GGHFMEPVPGGDLIRAPEILPTGRNIHAFDPFRMPTAFALQDGAAQAQRLLDAHPKLPET
VALVLWGSDNIKSDGGPIAQALALMGARPRFDHYGRLAGADLIPLSELGRPRIDVIMTLS
GIFRDLLPLQTRMLAEAAWKCANAEGEPLSQNFIRAHALAYAQEMGVDMETASLRVFSNA
EGAYGSNVNVLVGSSAFGEEDELADAYEARKSFAYGRSGKPVQNAALLQKSLKTVDVAYQ
NLESVELGVTTVDHYFDTLGGIARAVKRAKGEEAAVYIGDQTRGGGTVRTLKDQIALETR
ARSLNPKYYEGLLRHGAEGVRQIEAQVTNTLGWSATTQQVEPWVYQRLSETFVLDEAMRR
RLAELNPEASVRMAERLLEASARNYWQPDAETLAALQGAADELEDRLEGIAAE
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggtgaagtctcaggttcggccggcgtgaccggctacaacatcgtcatcgtcacc
ctcgacgcccacgcggcggggcccgccgcgcggatcgcgccgcggctgcggcaggacttt
ccgggcctcacggtctcgatccatgccgccgccgaatgggccgaaaagcccgagacgctg
gtgcgcgcgaaagaggcgatcaacagcgccgatctcgtgatcgccaacctcctcttcatc
gaggaacatatcaacgccgtcctccccgagcttcaggccgcgcgcgagcgcgccgatgcc
ttcgtcggcatgatcgccgatccccagatcgtgaagctcacgaagatgggcgacctcgac
atgcagaagccggcctcggggccaatggcgcttctgaagaagctgcgcggctcctcgaag
gaatcgggcaacaccggcgaaagccagatgcggatgctccgcaccatcccgaagatgctg
aagttcgtccccgggaaggcgcaggacctgcgggcctggttcctggccatgcaatactgg
ctcggcggctccgacgacaacctcgagcagatgatgcgctatctcgtctcgcgctactcg
cgcgtgcgcgaatggcacaaggtcagcgccaaggctccgatcgaatatcccgaggtcggc
ctctatcacccgagcctgcccaaccgcatcaccaccgacccgaacgacctgccccgcccc
gcgagcgcgaaggtcacggtcggcctcctgatgctgcgctcctacatcctggcctccgac
accgcccattatgacgcggtgatcgaggccttcgagcagaagggcatcgcggtcctgccg
gcctttgcgggcgggctcgacgggcgcccggcgatcgacgcctacttccacgacaagctc
ggccccaccatcgacgcgatggtgtcgctgaccggcttcagcctcgtcggcggcccggcc
tacaacgacagccacgccgcgatcgaggcgctgaaggcgctcgatgtgccctacatcgcc
gcccacccgctcgagttccagacgctcgggcaatgggctcaggccggcggcggactcggc
ccggtcgagaccacgatgctcgtggcgctgcccgagatcgacggcgcgaccaaccccacc
gtcttcgccggccgccatgacctggccggctgcgacggctgccccggcggctgccgcgcc
accgcgcaaggcgccgagacgcgcgcgatggctccctgccacgagcgcatccagacgctc
gcggaaaagaccctgcgcctcgccctcctccgccgctcgaaggtggccgagcgcaaggtt
ggcgtcgtcctctacggcttcccgccgaacgcgggcgcggtcggcaccgccgcctatctc
ggcgtgttcgaaagcctgttcaacgtgctgaacgcgatgaagcgcgaaggctaccagctc
gaggttcccgaaagcgtgcaggcgctgcgggacgcggtcctcggcggcacctcgagccag
tatggccagcccgcgaacatcgcggcccatgtcccggccgagaagatcgtctcgggcacc
ccctggcttgccgacatcgagaaggcctggggcgccgcccccggccgcatccagtcggac
ggccgcggcgtctacatcctcggccagaacttcggcaatgtcttcgtgggcatccagccg
gtcttcggctacgagggcgacccgatgcggttgctcttcgagaagggcttcgcccccacc
catgccttcagcgtcttctatcgctggctgcgcgaggatttccacgccgatgtgctcttg
catttcgggatgcacggtgcgctggagttcatgcccggcaagcaggccggcatgtcgggc
gcctgctggccggatcgcctgatcggcgccctgccgaacgtctatctctacgccgcgaac
aacccctccgaagcctcgctcgccaagcgccggaccaacgcgatcaccgtctcgcacctg
acgcccccgctgacgcaggccggcctctaccgcgggctgcaggatctgaaggacagcctg
acgcgctaccgtcagctcgccccggaagcccctgaacgcgaagagctttccctgctgatc
caggagcaggcccgcgccgtcaacctcgacatgcacccggtcgagacgatgtggctgaag
ctgctggagaccgagggctcgctcatcaccgacggcctgcatgtcgtgggaacgcccatg
accgaagagcagatcgcggccaacatcgcgctgatgcccgaaatggacgcggaccgccgc
gccgaggtcgagaacctcctgcggcaggagaccgagatccccggcgtcctgcgcgccttg
ggtggccatttcatggagccggtgccgggcggtgacctgatccgcgcgcccgagatcctg
cccacgggccgcaacatccacgccttcgacccgttccgcatgcccacggccttcgcgctg
caggacggcgcggcgcaggcgcagcggctgctggatgcccatccgaagctgcccgagacg
gtggcgctggtgctctgggggtctgacaacatcaagtcggacggcgggccgatcgcgcag
gcgctggcgctgatgggggcgcgtccccgcttcgaccattacggccgtctcgcgggtgcc
gacctcatcccgctctcggaactgggccgtccgcggatcgacgtgatcatgaccctctcg
ggcatcttccgcgacctgctgcccttgcagacccggatgctggccgaggccgcgtggaaa
tgcgccaatgcggaaggtgagccgctgtcgcagaacttcatccgcgcccatgctctcgcc
tatgctcaggaaatgggcgtggacatggagaccgcctcgctccgcgtgttctcgaacgcg
gaaggcgcctatggctcgaacgtgaacgtgctggtgggctcgtccgccttcggtgaggaa
gacgaactggccgacgcctacgaggcgcggaagtccttcgcctatggccgctcgggcaag
ccggtgcagaacgcggcgctcttgcagaagtcgctcaagaccgtggacgtggcctaccag
aacctcgagtccgtggaactgggcgtgaccaccgtcgaccattacttcgacacgctcggc
ggcatcgcccgcgcggtaaagcgggccaagggcgaggaagcggcggtctatatcggcgac
cagacccgcggcggcggcaccgtccgcacgctcaaggaccagatcgcgctggaaacccgc
gcccgcagcctgaaccccaaatattacgaggggcttctgcgtcacggcgccgagggcgtc
cggcagatcgaggcgcaggtgaccaacacgctcggctggtcggccacgacccagcaggtg
gaaccgtgggtctaccagcgcctgtccgagaccttcgtgctggacgaggcgatgcgccgc
cgtctggccgaactgaaccccgaggcgagcgtccgcatggccgaacgccttctggaagcg
agtgcccgtaactattggcagcccgacgcggaaacgcttgccgcgcttcagggggctgcg
gacgagttggaagaccgtctcgaagggatcgccgccgagtaa

DBGET integrated database retrieval system