KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1021Help
Entry
Rsph17025_1021    CDS       T00512                                 

Gene name
bchD
Definition
magnesium chelatase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rsph17025_1021 (bchD)
Enzymes [BR:rsq01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Rsph17025_1021 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1046874..1048514)
Genome map
AA seq 546 aa AA seqDB search
MLAVDPVGLKGLWLRARACPLRDRVTAALSALPLPLRRIHPTIGDDALFGGLDLAATLST
GSPVVQKGILDEPAALVLAMAERATPGLAARIGTALDEPRHCLIALDEGAERDELLPLGL
VDRLGLFIDIDGLPWGDTRDIAIDPERLAAARARLAGVKTPARAGETLARVAAQCGIASL
RAPTLALAAARAQAAWEGHEAITEDDLRRAADLVFAHRALPASEEAPPEPEPEPPEDQPD
DTPPPPEQEQQQGEELFPEEMLVEAVRAALPSDLLEQLAAGRAARMARGATGTGSAKSGN
RRGRPLPSRMGRLGTGARIDLVGTLRAAAPWQPLRRRQQQSDAILLVRPSDIRIKRFRET
SDRVLIFAVDASGSSAMARLSEAKGAVELLLGQAYARRDHVSLLAFRGRDAELILPPTRS
LVQTKRRLAGLPGGGGTPLAHGLRLALAVGLQARARGMTPTVALLTDGRGNIALDGSANR
ALAEEDALKLAASLRASGLPAIVIDTANRPQPSLANLARALDAPYIALPRADAHRLSSVI
GAAMGD
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgcggtcgatccggtcggcctcaagggcctctggcttcgcgcgcgggcctgtccg
ctgcgggacagggtgacggcggcgctgtccgcgctgccgctgcccctccgccgcatccat
cccaccatcggcgacgatgccctgttcggcgggctcgatctggccgcgacgctctcgacc
ggctcgccggtggttcagaagggaatcctcgacgagcccgcggcgctggtcctcgccatg
gcggaacgcgcgacgccgggtcttgccgcccggatcggcaccgcgctcgacgagccgcgc
cactgcctgatcgcgctcgatgagggcgccgagagggacgagcttctgccgctgggcctc
gtggaccggctggggctgttcatcgacatcgacggcctgccatggggcgacacgcgcgac
atcgcgatcgacccggaacgtctggccgcggcccgcgcccgtctggcgggcgtgaagacc
ccggcccgcgcgggcgagacgctggcccgggtggccgcgcaatgcggcatcgcgagcctt
cgggcgccgacgctggcgctggccgcggcccgcgcacaggccgcctgggaaggccacgag
gcgatcaccgaggatgacctgcgccgcgccgccgatctggtcttcgcccaccgcgcgctg
cccgcctcggaagaggccccgcccgagcccgagccggaaccgcccgaggatcagcccgac
gacaccccgccgccgcccgagcaggagcagcagcagggggaggagcttttccccgaggag
atgctggtcgaggcggtgcgcgccgccctgccctcggacctgctcgagcagctggccgcc
ggccgcgcggcgcgcatggcgcgcggcgccacggggaccggctcggccaagtcgggcaac
cgccgcggtcgccccctgccctcgcgcatgggccgcctcggcaccggcgcgcggatcgat
ctggtcggcacgctgcgggccgcggccccctggcagccgctgcgccgccgccagcagcaa
tcggacgccatccttctggtgcgcccctcggacatccgcatcaagcgtttccgtgagacc
tcggaccgggtcctgatcttcgccgtggacgcctcgggctcgtcggcaatggcgcgcctg
tcggaggccaagggagcggtggaactgctgctgggccaggcctacgcgcggcgcgaccat
gtctcgctgctggccttccgcggccgcgacgccgagctgatcctgccgccgacccgcagc
ctcgtgcagaccaagcgccggctggcggggctgcccggcgggggcggcacgccgcttgcg
cacgggctgcggctggcgctggcggtggggttgcaggcccgcgcgcgggggatgaccccg
acggtggcgcttctgaccgacgggcgcgggaacattgccctcgacggttcggccaaccgg
gcgctggccgaggaggatgcgctgaagctcgccgcgtcgctgcgcgcctcgggcctgccg
gcgatcgtgatcgacacggccaaccggccgcagccctcgctggccaacctcgcccgtgcc
ctcgacgcgccttacatcgcgctgccgagggccgacgcccaccggctctcgtcggtgatc
ggtgcggcgatgggagactga

DBGET integrated database retrieval system