KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1092Help
Entry
Rsph17025_1092    CDS       T00512                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00010  Glycolysis / Gluconeogenesis
rsq00020  Citrate cycle (TCA cycle)
rsq00620  Pyruvate metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01200  Carbon metabolism
Module
rsq_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17025_1092
   00020 Citrate cycle (TCA cycle)
    Rsph17025_1092
   00620 Pyruvate metabolism
    Rsph17025_1092
Enzymes [BR:rsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rsph17025_1092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABP69993
JGI: Rsph170251092
UniProt: A4WRH9
Position
complement(1116972..1118288)
Genome map
AA seq 438 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLKKEGDEVRSGDILAEIETDKATMEFEAVDEGILGKIL
IAEGTAGVKVNTPIAVLVEEGESADAVSSGKTPAPEEPKDEAAPAQEAPKASPAASPAPA
AKPEGDRIFASPLARRIATEKGLDLATVKGSGPRGRIVKADVEGAQKPAAPAAKAEAAAP
QADAPAAAAAPVTSPAASAASVAKLFADREFEEITLDGMRKTIAARLSEAKQTIPHFYLR
REVALDALMAFRADLNAKLESRGVKLSVNDFIIKACAVALQQVPNANAVWAGDRILRLKP
SDVAVAVAIEGGLFTPVLRDAHQKSLSALSAEMKDLAARARTKKLAPHEYQGGSFAISNL
GMFGIENFDAVINPPHGSILAVGAGIRKPVVAKDGAITTATMMSMTLSVDHRVIDGALGA
EFLKAIVENLENPIAMLA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgagatccttatgcccgcgctgtctccgacgatggaggaggggacgcttgcg
aaatggctgaagaaggagggggatgaggtccgctcgggcgacatcctcgccgagatcgag
accgacaaggcgacgatggagttcgaggcggtggacgaggggatcctcggcaagatcctg
atcgccgagggcaccgcgggcgtgaaggtgaacacgcccatcgccgtgctggtggaagaa
ggcgagagcgcggacgcggtctcgtcgggcaagacgcccgcgcccgaagagcccaaggac
gaggccgcgcccgcgcaggaggcgccgaaggccagccccgccgcctcgccggcgccggct
gcgaagcccgagggcgatcgcatcttcgcctcgccgctggctcggcggatcgcgacggag
aaggggctcgaccttgccacggtcaagggatcgggcccgcgcggccggatcgtgaaggcc
gatgtcgagggggcgcagaaacccgccgccccggccgcgaaggccgaagccgcggcgccc
caggcggatgctccggctgccgctgcggcccccgtgacctcgccggccgcctcggcggcg
tcggtcgcaaagctctttgccgaccgcgagttcgaggagatcaccctcgacggcatgcgc
aagaccattgccgcgcgcctgtccgaggccaagcagaccatcccgcacttctacctccgc
cgcgaggtggcgctggatgcgctgatggccttccgggcggacctcaacgcgaagctcgag
agccggggcgtgaagctctcggtcaacgacttcatcatcaaggcctgtgcggtggctctc
cagcaggtgccgaacgcgaacgccgtctgggctggagaccgcatcctgcggctcaagcct
tcggacgtggcggtggccgtggccatcgagggcgggctcttcacgccggtcctgcgcgat
gcgcaccagaagagcctgtcggccctctcggccgagatgaaggatctggccgcccgtgcc
cgcacgaagaagctcgctccacacgaatatcagggtggcagcttcgcgatctcgaacctc
ggcatgttcgggatcgagaatttcgacgcggtcatcaacccgcctcatggctcgatcctt
gcggtcggcgcaggcatccgcaagcccgttgtggccaaggacggcgcgatcacgaccgcc
acgatgatgtcgatgacgctctcggtggatcaccgggtgatcgacggcgcgctgggggcc
gagttcctcaaggcgatcgtcgagaacctcgagaacccgatcgcgatgctcgcctga

DBGET integrated database retrieval system