KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1111Help
Entry
Rsph17025_1111    CDS       T00512                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rsph17025_1111
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Rsph17025_1111
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1136021..1136986
Genome map
AA seq 321 aa AA seqDB search
MALEDAKNEVDVAFTRADARGYACENAFAGATSFLRRRYTKDLTGVDLAITGVGFDQAVT
NRTGTRFGPRAIREASTVQPYDRPFGWGFDPLETMTVVDYGDLAFDYARTADFPGRLTAH
VAGILAAGAGAITLGGDHSITLPILRAHAAVFGPLSVVQFDAHSDLWVDDDPGRIDHGTF
MYKAVKEGLVDPARSVQVGIRTDTPDWLGMNVIDARTVHEQSTAAIATRVRDIVGAHPVY
LTFDIDALDPAFAPGTGTPVWGGLASWQAAAILRDLAGVALVGGDVVEVSPPYDSAGITA
VAGAHVAYELICLYGWRRRKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggcactggaagatgcgaagaacgaagtggacgtggccttcacccgggccgacgcccgc
ggctacgcctgcgaaaacgccttcgcgggcgccacgagcttcctgcgccgccgctacacc
aaggacctgaccggcgtcgatctggcgatcaccggcgtgggcttcgaccaggcggtgacg
aatcgcaccggcacccgcttcggcccccgcgcgatccgcgaggcctcgaccgttcagccc
tacgaccggcccttcggctggggcttcgacccgctcgagacgatgacggtggtcgattac
ggagacctcgccttcgactacgcccggaccgcggatttccccggccgcctcaccgcccat
gtcgcggggatcctggccgcgggggcgggggcgatcacgctcggcggtgaccattcgatc
acgctgccgatcctgcgcgcccatgcggcggtcttcggcccgctctcggttgtccagttc
gacgcccattccgatctctgggtcgatgacgaccccggccggatcgaccacggcaccttc
atgtacaaggccgtgaaggagggtctcgtcgatcccgcccgctcggtccaggtgggcatc
cgcaccgacacgccggactggctcggcatgaacgtgatcgacgcgcgcaccgtgcacgag
cagagcacggccgcaatcgcgacccgcgtgcgcgacatcgtgggcgcgcatccggtctac
ctgaccttcgacatcgacgcgctcgaccccgcctttgcccccggcaccggcaccccggtg
tggggtgggctcgcctcctggcaggcggccgccatcctgcgcgatctggcgggtgtcgcg
cttgtcggcggcgatgtggtcgaggtctcgcccccctacgattccgccggcatcaccgcc
gtcgcgggggcccatgtagcctacgagttgatctgtctctatggttggagaaggcgcaag
gaatga

DBGET integrated database retrieval system