KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1123Help
Entry
Rsph17025_1123    CDS       T00512                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rsph17025_1123
   00240 Pyrimidine metabolism
    Rsph17025_1123
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Rsph17025_1123
   03430 Mismatch repair
    Rsph17025_1123
   03440 Homologous recombination
    Rsph17025_1123
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Rsph17025_1123
DNA replication proteins [BR:rsq03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Rsph17025_1123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1149918..1150394
Genome map
AA seq 158 aa AA seqDB search
MFYHLTRSSAEDTLRLLLPRALAQGWRVMLRGTDRGRLEALDLALWRVPEDGFLPHGMEG
GPQDAAQPVLLGTGAIGNGAQALMLLDGAETDAAEAGPLERVWILFDGLDEGQLVHARGQ
WKALTGAGLKAQYWSEESGRWEKKAEAGQDAAGAERRD
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgttctaccacctgacgcgctcctcggccgaggatacgctgcggctgctgttgccgcgg
gcgctggcgcaggggtggcgcgtgatgctgcgcggcacagaccgggggcggctcgaggcg
ctggaccttgcgctctggcgcgtgccggaggacgggttcctgccgcacgggatggagggc
gggccgcaggacgcggcccagccggtgctgctcgggacgggcgcgatcggcaacggggcg
caggcgctgatgctgctggacggggccgagaccgacgccgccgaggcggggccgctcgag
cgggtctggatcctgttcgacgggctcgacgaggggcagctggtccatgcgcgcggccag
tggaaggcgctgacgggggcgggtctcaaggcgcaatactggtcggaggagagcgggcgc
tgggagaagaaggccgaggcgggccaggacgccgcaggcgccgagcgccgcgactga

DBGET integrated database retrieval system