KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1145Help
Entry
Rsph17025_1145    CDS       T00512                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17025_1145
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17025_1145
   00052 Galactose metabolism
    Rsph17025_1145
   00500 Starch and sucrose metabolism
    Rsph17025_1145
   00520 Amino sugar and nucleotide sugar metabolism
    Rsph17025_1145
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rsph17025_1145
   00524 Butirosin and neomycin biosynthesis
    Rsph17025_1145
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Rsph17025_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1179036..1179989)
Genome map
AA seq 317 aa AA seqDB search
MDDAPLCLVADIGGTNTRVALAQGPRLMAETTRRFRNRDYPALAPVLRDFLAAAGSPEID
GACVAAAGPVRDGVATLTNLDWTVDGAELLRATGAPRVAVLNDLQAQGHALGHVDQANLR
MLIPGPHPRRAGPMLVIGVGTGFNAAPVHDMPGLRVVAASECGHAGMPVRTERDLRLAQF
VQKVHGFAGVEDVLSGRGLERLYAFTASEAGLEDRKSAAGITAAVAEPGPARAAAELFAR
ILGAEAGNLALIHLPFGGIFLCGGVARAFAAHLGPMGFAESFRDKGRFSAFMDDFPVCIV
EDDYAALTGCATYLATI
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggacgacgcccccctctgtctcgtcgccgacatcggcggcacgaacacgcgcgtggcg
cttgcgcagggtccgcggctgatggccgagacgacgcggcgcttccgcaaccgtgactat
ccggcgctcgccccggtgctgcgcgatttcctggccgccgccggcagccccgagatcgac
ggcgcctgcgtggcggcggcgggcccggtgcgcgacggtgtggccacgctcaccaacctc
gactggacggtggacggggccgagcttctgcgcgcgacgggggcgccccgggtggcggtg
ctgaacgatcttcaggcacagggccacgcccttggccatgtcgatcaggcgaacctgcgg
atgctgatccccggcccccatccgcgccgcgcggggcccatgctggtcatcggcgtgggc
accggcttcaacgcggcgcccgtccacgacatgccggggctgcgggtggtggcggcttcg
gaatgcggccacgcgggaatgccggtccgcaccgagcgcgacctgcgccttgcgcagttc
gtgcagaaggtccacggctttgccggggtcgaggacgtgctctcggggcgaggtctcgag
cgcctctacgccttcacggcctccgaagcggggctcgaggatcggaaatccgccgccggg
atcacggcggccgtcgccgagccggggccggcccgcgcggcggccgagctcttcgcccgc
atcctcggggccgaggcgggcaatctcgccctgatccatctgccctttggcgggatcttc
ctctgcggcggcgtcgcgcgcgccttcgccgcccacctcgggccgatgggctttgccgag
agcttccgcgacaagggccgcttttcggccttcatggacgacttccccgtctgcatcgtc
gaggacgactacgccgccctgaccggctgcgccacctatctcgcgacgatctga

DBGET integrated database retrieval system