KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1168Help
Entry
Rsph17025_1168    CDS       T00512                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17025_1168
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Rsph17025_1168
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Rsph17025_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1210583..1211509)
Genome map
AA seq 308 aa AA seqDB search
MPKTCILIGAPIDSGQRRPGCLMGPAAYRVAGLGRALTDLGHAVEDRGDVAPGPLPAVAT
SDPRLHALPETIGWTIALKEAVEDALGRGFPIVMGGDHSLALGTVAGAAAHAAAVGRPLF
LLWLDAHSDFHTLQTTTSGNLHGVPVAYAAGRDGFDGFPPFPAPLPPERICLFGIRSVDP
EEHAALLLHDISIIDMRVIDEFGICAPMREFLEKVRAANGMLHVSLDVDFVDPAHAPAVG
TTVPGGATVREAHLVMELLHESGLVTSLDLVELNPFLDERGRTARLMVELAASIMGRKVF
DRPTRGFG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagacctgcatcctgatcggggcaccgatcgacagcggccagcgtcggccgggc
tgcctgatggggccggcggcctatcgcgtggcgggcctgggccgggccctgacggatctc
ggccatgcggtcgaggaccggggcgacgtggcgccggggccgctgccggcggtcgccacc
tccgatccgcgcctccatgcgctgcccgagacgatcggctggacaatcgccctgaaggaa
gcggtcgaggacgccctcggccgcggctttcccatcgtgatgggcggcgaccattcgctc
gccctcgggaccgtggcgggggccgcggcccatgcggcggccgtgggacggccgctgttc
ctgctgtggctcgatgcgcattccgatttccacacgctccagaccaccacctcgggcaat
ctgcatggggtgccggtggcctatgccgcgggccgcgacgggttcgacggcttcccgccc
ttccccgcaccgctgccgcccgaaaggatctgcctcttcggcatccgctcggtcgatccc
gaggaacatgcggcccttctgctgcatgacatctcgatcatcgacatgcgggtgatcgac
gagttcggcatctgcgcccccatgcgcgagttcctcgagaaggtgcgcgcggccaacggg
atgctgcatgtctcgctcgacgtggatttcgtcgatcccgcgcacgcgcccgctgtcggc
acgaccgtgcccggcggcgccacggtgcgcgaggcgcatctggtgatggagcttctgcac
gaaagcggcctcgtgacctcgctcgatctggtggaactgaatcccttcctcgacgagcgc
gggcgcaccgcgcggctgatggtcgaactggccgcctcgatcatggggcgcaaggtgttc
gaccggccgacgcgcggcttcggctga

DBGET integrated database retrieval system