KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1200Help
Entry
Rsph17025_1200    CDS       T00512                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rsph17025_1200
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Rsph17025_1200
Exosome [BR:rsq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17025_1200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1241678..1243159)
Genome map
AA seq 493 aa AA seqDB search
MSHILAIDQGTTSSRAMVFDASLSLKSVAQEEFPQIYPRPGWVEHDPTDLWSSVAATARA
AVERAEIDGSLAAIGITNQRETVVIWERATGHPIHNAIVWQDRRTADLCQSLAEAGQEPM
ITERTGLLLDPYFSATKVKWLLDHVEGARARARRGELLFGTVDSYLIWKLTGGRSHVTDA
TNAARTMLFDIRRGEWDAEICGLLDIPMEMLPEVKDCAAPFGMTRADLFGREIPILGVAG
DQQAATCGQACFRPGMMKSTYGTGCFALLNTGAERVTSRSRLLTTIAYQLGGQRTYALEG
SIFIAGAVVQWLRDGLKIIREAGETHGLATASDAAQDLVIVPAFTGLGAPWWKPDSRGAV
FGLTRNSGPAEFARAALESVGYQTRDLLEAMRADWAAGAEGVLRVDGGMTASDWSMQFLA
DIIGAPVDRPVVRETTALGAAWLAGMQAGLCPGPEEFAAGWALERRFEPRMEAATRDAKY
ARWGRAVRAVMAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagccacatcctcgccatcgatcagggcaccacctcctcgcgcgcgatggtcttcgac
gcgagcctctcgctgaagtcggtcgcgcaggaggagtttccgcagatctacccccgcccc
ggctgggtcgagcatgatccgaccgacctctggtccagcgtcgccgcaacggcgcgcgcc
gcggtcgagcgggccgagatcgacggcagcctcgccgccatcggcatcaccaaccagcgc
gagacggtggtgatctgggaacgcgccaccggccatccgatccacaatgcgatcgtctgg
caggaccgccgcaccgccgacctctgccagagcctggccgaagcggggcaggaacccatg
atcaccgagcggacggggctgctgctcgacccctatttctcggccaccaaggtcaagtgg
ctgctcgaccatgtcgagggcgcgcgcgcgcgggcccggcggggcgagttgctgttcggg
acggtggacagctacctcatctggaagctgacgggggggcggtcccatgtgaccgacgcc
accaacgccgcgcgcaccatgctcttcgacatccgccgcggcgaatgggacgccgagatc
tgcggtctgctcgacatcccgatggagatgctgcccgaggtgaaggactgcgccgcgccc
ttcggcatgacgcgggcggacctcttcgggcgcgagatcccgatcctgggcgtcgcgggc
gaccagcaggccgccacctgcgggcaggcctgcttccgccccggcatgatgaaatcgacc
tacgggacgggctgcttcgcgctgctcaacacgggggcggaacgtgtgacgagccgctcg
cgcctgctcaccaccatcgcctaccagctgggcgggcagcggacctatgcgctcgagggc
tcgatcttcatcgcgggcgccgtggtgcaatggctgcgcgacgggctgaagatcatccgc
gaggcgggcgagacgcacgggctggccacggcctcggacgcggcgcaggatctggtgatc
gtgccggccttcaccggccttggcgcaccctggtggaagccggacagccggggcgcggtc
ttcggcctgacgcgcaactccggccccgccgagttcgcccgcgccgcgctggagagcgtg
ggttaccagacgcgcgacctgctcgaggcgatgcgggcggactgggcggcgggcgccgag
ggggtgctgcgggtggacggcggcatgaccgcctcggactggtcgatgcagtttctggcc
gacatcatcggcgcgccggtggaccggccggtggtgcgcgagacgacggcgctcggcgcg
gcctggctggccgggatgcaggcgggcctctgccccggccccgaggagttcgcggccgga
tgggcgctggagcggcgcttcgagccgaggatggaggcggcgacgcgcgacgcgaaatac
gcccgctggggacgggccgtgcgcgcggtgatggcggtatga

DBGET integrated database retrieval system