KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1231Help
Entry
Rsph17025_1231    CDS       T00512                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rsph17025_1231 (ruvA)
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Rsph17025_1231 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1273401..1274075
Genome map
AA seq 224 aa AA seqDB search
MIGKISGILDFRGPDHVLIDVRGVGYIVHVSDRTLAAMPAPGEGVALYTELVVREDLLQL
FGFTTMIEKEWHRLLMTVQGVGAKAGMAILGALGAEGVARAISLGDARSIQAAPGVGPKI
AQRVVLELKSKAPALMVMGGAAPARAAAVVEETPEEPAPRRKPSTRAAPPPAANHTGDAL
SALTNLGYQPSDAAQAVAQASGDNPQADAAALIRAALKLLAPRS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagatctcggggatcctcgacttccgcgggcccgaccatgtgctgatcgac
gtgcgcggcgtgggctacatcgtccatgtctcggaccggacactggccgccatgcccgct
ccgggcgagggggtcgcgctctataccgaactcgtggtgcgcgaggatctgctccagctt
ttcggttttaccaccatgatagaaaaggaatggcaccggctgctgatgacggtgcagggg
gtgggcgccaaggccggcatggccatcctcggtgcgctcggggccgagggggtcgcgcgg
gcgatcagcctgggcgacgcgcgctcgatccaggccgcgccgggagtcggccccaagatc
gcgcagcgcgtggtgctcgagctgaagtccaaggcaccggcgctgatggtgatggggggc
gccgcgccggcgcgcgccgctgcggtggtggaggagacgccggaagagcctgcgccgcgc
cgcaagccctcgaccagggccgcccccccgccggctgcgaaccacacaggggatgcgctc
tcggcgctgaccaacctcggctaccagccgtcggacgcggcgcaggccgtggcgcaggcg
tctggcgacaatccgcaggccgacgctgcggcgctgatccgggccgcgctgaagctgctc
gccccgagatcctga

DBGET integrated database retrieval system