KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1498Help
Entry
Rsph17025_1498    CDS       T00512                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rsph17025_1498
Enzymes [BR:rsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rsph17025_1498
Exosome [BR:rsq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rsph17025_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1531019..1532020)
Genome map
AA seq 333 aa AA seqDB search
MRPIQAAYPHARFRRVRRTDALRRLTQENTLTAGDLIWPLFVRDGENVEEPIHSMPGVVR
RSVDNIVKAAEEAASLGIPAVCLFPYTDPSLKTEACEEAWNPDNLANRAIRAIKAAVPEV
AVMTDVALDPYNANGHDGLVRDGIILNDETVEALVKMALVQAECGADILGPSDMMDGRIG
AMRSALEAAGHKDVAILSYSAKYASAFYGPFRDAVGASGALKGDKKTYQMDPGNSDEALR
LIERDLREGADMVMVKPGMPYLDICRRVKDAFGVPTYAYQVSGEYAMIKGAAERGWIKGE
ATMMESLLCFKRAGCDGILTYFAPEAARLLRDA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccgatccaagccgcctacccccacgcccgtttccgccgcgtccgccgcaccgac
gccctgcgccggctgacgcaggaaaacacgctgacggcgggcgatctgatctggccgctg
ttcgttcgcgacggggaaaatgtcgaagagccgatccattcgatgcccggcgtcgtgcgc
cgctcggtggacaatatcgtgaaggcggcggaagaggcggcgagcctcggcatcccggcc
gtctgcctctttccctacaccgacccctcgctcaagacggaagcctgcgaggaagcctgg
aaccccgacaacctcgcgaaccgggcgatccgggcgatcaaggcggcggtgcccgaggtg
gcggtgatgaccgacgtggcgctcgatccctacaacgccaacggccacgacgggctggtg
cgcgacgggatcatcctcaacgacgagaccgtcgaggcgctggtgaagatggcgctggtg
caggccgagtgcggcgccgacatcctcgggccgtccgacatgatggacggccgcatcggc
gcgatgcgctcggcgctggaagccgcgggccacaaggatgtggcgatcctgagctattcg
gcgaaatacgcctcggccttctacggcccgttccgcgatgcggtgggcgcctcgggcgcg
ctgaagggtgacaagaagacctaccagatggacccgggcaacagcgacgaggcgttgcgt
ctgatcgagcgcgacctgcgcgagggcgccgacatggtgatggtcaagccgggcatgccc
tatctcgacatctgccgccgggtgaaggacgccttcggcgtgccgacctacgcctaccag
gtctcgggcgagtatgcgatgatcaagggcgccgccgagcgcggctggatcaagggcgag
gccaccatgatggagagcctgctctgcttcaagcgcgcgggttgcgacggcatcctgacc
tatttcgcccccgaggccgcgcggcttctgcgcgacgcctga

DBGET integrated database retrieval system