KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1563Help
Entry
Rsph17025_1563    CDS       T00512                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rsph17025_1563
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rsph17025_1563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1602436..1603398
Genome map
AA seq 320 aa AA seqDB search
MSAAPFHTEIARGPDGVRAQWISAQDGVRLRSVIWPEGGRGTVLLFSGRTEYAEKYGPAA
DQLRRRGYASATLDWRGQGLSDRSLRDPLVGHIGDFAEYQRDVAAFVAHVRAQGLPEPYH
LLAHSMGGSIGLRALQEGLAVRSACFSAPMWGIRVHAALRVVAAALGALARRTGLGHRYV
PGTGTRSYVVATAFEANVLTRDREMFAWMQDQLARVPELGLAGPSLDWLRAAFAETHRLS
HLPSPRLPALCIVGSAEKVVDLDEIRRRMDGWRGGELQIVPGAEHEVMMDRPEVRDAFFD
AATALFDRAAEATPLRSGSA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcggcgcccttccacaccgagatcgcgcgcgggcccgacggcgtccgtgcgcag
tggatcagcgcccaggacggcgtgcggctgcgcagcgtgatctggcccgagggcggcagg
ggcaccgtgctgctcttttcgggccgcaccgaatatgccgagaaatacgggcccgcggcc
gaccagctgcgccgccgcggctatgcctcggccacgctcgactggcgcggacagggcctc
tccgaccgctcgctgcgcgaccctctggtggggcatatcggcgactttgccgaatatcag
cgggatgttgcggcgttcgtcgcgcatgtccgggcgcagggcctgccggagccctatcac
ctgctggcccattcgatggggggcagcatcggcctgcgcgcgctgcaggaggggcttgcg
gtgcgctcggcctgcttctcggcgccgatgtggggcatccgggtccatgcggcgctgcgg
gtcgtggcggccgccctgggggcgcttgcgcgcaggacggggctcggccatcgctatgtc
cccggcaccggcacgcgcagctatgtggtcgccaccgccttcgaagcgaacgtgctcacg
cgcgaccgcgagatgttcgcctggatgcaggaccagcttgcgcgcgtgcccgaactgggc
ctggccggccccagtctcgactggctgcgtgcggcctttgccgagactcatcgcctttcg
catctgccctccccccgacttcccgcgctctgcatcgtgggttcggccgagaaggtcgtc
gatctggacgagatccggcgccggatggacggctggcggggcggagagctgcagatcgtg
cccggcgccgagcatgaggtgatgatggaccgccccgaggtccgcgacgccttcttcgac
gccgcgaccgcccttttcgaccgggcggccgaggccaccccgctcagatccggatctgcg
tga

DBGET integrated database retrieval system