KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1592Help
Entry
Rsph17025_1592    CDS       T00512                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rsph17025_1592
   01230 Biosynthesis of amino acids
    Rsph17025_1592
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17025_1592
   00030 Pentose phosphate pathway
    Rsph17025_1592
   00051 Fructose and mannose metabolism
    Rsph17025_1592
   00052 Galactose metabolism
    Rsph17025_1592
  Energy metabolism
   00680 Methane metabolism
    Rsph17025_1592
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rsph17025_1592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1633132..1634076
Genome map
AA seq 314 aa AA seqDB search
MIPILTLTLNPAIDLAADVPQVLPGIKLRCTEPRVDPGGGGLNVSRAIRILGGQSTAFVA
LGGNVGGRLAALIAAAGIEIVAFAGPGETRESLTVTETGTGQQFRFMLPGARWSPARVEA
ALARIDRAVPKGGMVVLSGSLPPGVPADFPALVSNLLGQRARLLVDTSGAPLAHLAAGGV
PDLDILRMDDGEAASLAGRPLDSVAETADFASALVARGVAGCVIIARGADGSVLADARGR
WHSRSEPVEVVSAVGAGDTFVGAFVLALARGAPPETALAHGVAAAAAAVITEATELCHPE
DVERLLPSCAPHPV
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgatccccatcctgacgttgacgctgaacccggcgatcgaccttgccgccgacgtgccg
caggtgctgcccggcatcaagctgcgctgcaccgagcctcgggtcgatccgggcggcggc
gggctgaacgtcagccgcgccatccgcatcctgggtggccagagcaccgccttcgtggcg
ctcggtggcaacgtgggggggcggcttgcggcgctgatagcggcggcgggcatcgagatc
gtggccttcgccggccccggcgagacgcgcgagagcctgacggtgaccgagaccggcacc
ggccagcagttccgcttcatgctgcccggcgcccgctggagccccgcccgcgtcgaggcc
gccctcgcccgcatcgaccgcgccgtgcccaagggcggcatggtggtcctctcgggctcg
ctgccgccgggggttccggccgatttcccggccctcgtgtcgaaccttctgggccagcgc
gcgcgtctgctggtggacacgtcgggcgcccccctcgcccatctcgcggccgggggcgtg
ccggatctcgacatcctgcggatggacgatggcgaggcggcgagcctcgccggccgacca
ctcgacagcgtggccgagaccgcggacttcgcctcggccctcgtggcccgcggcgtggcc
ggatgcgtgatcatcgcccggggcgccgacggctcggtgcttgccgacgcccgcggccgc
tggcactcgcgctcggagccggtcgaggtggtcagcgcggtcggcgccggcgacacgttc
gtcggcgccttcgtcctcgcactggcccgcggcgcgccgcccgagaccgccctcgcccac
ggcgtcgccgccgccgccgccgccgtcatcaccgaggccaccgaactctgccaccccgag
gatgtcgagcgtctgctcccctcctgtgccccgcacccggtctga

DBGET integrated database retrieval system