KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1780Help
Entry
Rsph17025_1780    CDS       T00512                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rsq00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1819517..1821334)
Genome map
AA seq 605 aa AA seqDB search
MSQTIEERAAEFAIQPSYHALGGEFVRPPVQTLRALLDAFGIPPEGPPPDRAPPVMRAPE
GEPCFLPEGEMRLWGIAAQLYQLRSGRNWGIGDFADLCALARIAGAAGADFIGLNPLHAL
FLANPAHTSPFSPSNRRFLNPLYIAVDRVPGYRDELAPEGLDRLRAPDLVDYPAVAAAKL
GALWRLWMEGPDDPVGFMRFCTEGGELLRRHALFEAISAKMVADGHGAGWRGWPVELQDA
KSPAVAEFAEAHAEDIGFHYWLQWIADRQLGEARDACRAAGMKIGLYLDFAVGEVPDGSS
TWSDPSLAVSGLRIGASPDWFNAQGQDWGLAPLSPVKLADLHAAPFGALMQDATRRAGAL
RIDHAMGVWQLFLIPDGMGAPQGTYVRYPIEDMLRVLAEASRRNRTIVIGEDLGNVPEGF
RELMARMNILSYRILLFERHDHGYIAPEHYPREALVCLSTHDLPTFRGWWRGDDVAIRRE
FHLISEEAARQQGEFRWTERRQLLEDLARAGLMGWDGIDRIGPEDPPEALLVAVHRHLAR
TPSRLLAVRIEDMAGEVAPVNVPSTVDEHPNWRRRLGVPLEALADTALFRGIAGAVAAER
PRESP
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaccattgaagaaagggcggcagagttcgccatccagcccagctaccacgcg
ctcgggggagagttcgtccgcccgccggtccagaccctgcgcgcgctgctggacgccttc
ggcatcccgccggaaggtccgccgcctgaccgcgccccgcccgtgatgcgcgcgccggag
ggcgagccgtgcttcctgcccgagggcgagatgcggctctgggggatcgcggcacagctc
taccagctgcgctccgggcgcaactgggggatcggcgactttgccgatctctgcgcgctg
gcgcggatcgcgggcgccgcgggggcggacttcatcgggctgaacccgctgcacgcgctc
tttctggccaatcccgcccacacaagtcccttctcgccctcgaaccggcgcttcctgaac
ccgctctacatcgcggtggaccgcgtgccgggctaccgggacgagcttgcgcctgagggg
ctcgatcggctgcgcgcgcccgatctggtggactatccggcggtggctgcggccaagctc
ggcgcgctgtggcgcctgtggatggaagggccggacgatccggtgggcttcatgcgcttc
tgcaccgaagggggcgagcttctgcggcggcacgcgctgttcgaggcgatctcggcgaag
atggtggcggacggacacggcgcaggctggcgcggctggccggtggagctgcaggatgcc
aagagccccgcggtggccgagttcgccgaggcccatgccgaggacatcggctttcactac
tggctgcagtggatcgccgaccggcagcttggagaggcgcgcgacgcctgccgcgcggcg
ggcatgaagatcgggctctatctcgacttcgccgtaggcgaggtgcccgacggatcgagc
acctggtcggacccgagccttgccgtgtcgggcctgcgcatcggcgcctcgcccgactgg
ttcaacgcacagggacaagactggggccttgcaccgctctcgcccgtcaagcttgccgat
cttcatgcggccccgttcggggcgctgatgcaggatgcgacgcggcgggcgggcgcgctg
cggatcgaccatgcgatgggggtctggcagcttttcctcatcccggacggaatgggcgcg
ccgcagggcacctatgtccgctacccgatcgaggacatgctgcgcgtgctggccgaggcc
tcgcgccgcaaccgcacgatcgtgatcggcgaggatctgggcaacgtgcccgaggggttc
cgcgagttgatggcgcggatgaacatcctctcctaccgcatcctgctcttcgagcggcac
gaccacggctacatcgcccccgagcattatccgcgcgaggcgctggtctgcctctcgacc
cacgatctgcccaccttccgcggctggtggcggggcgacgacgtggcgatccggcgcgag
ttccacctgatctcggaagaggccgcgcgccagcagggcgagttccgctggaccgagcgg
cgccagctgctcgaggatctggcgcgggcgggcctgatgggctgggacgggattgaccgg
atcggtccagaggatccgcccgaggcgctgttggtggcggtgcaccgtcacctcgcgcgc
acgccctcgcgtctcctcgcggtgcggatcgaggacatggcgggcgaggtggcgccggtg
aacgtgccctcgaccgtggacgaacatcccaactggcggcgcaggctcggcgtgccgctg
gaagctctcgccgacaccgcgctctttcgcggcatcgccggggccgtcgccgccgagcga
cccagggagtccccatga

DBGET integrated database retrieval system