KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1883Help
Entry
Rsph17025_1883    CDS       T00512                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rsph17025_1883
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rsph17025_1883
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rsph17025_1883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1932868..1933326)
Genome map
AA seq 152 aa AA seqDB search
MIVFDSIDGGEIRLDHLRARGPVLVVNTASLCGFTPQYDDLQDLSDRYAAQGLTVLAVPS
DDFRQELDDARAVRDFCATNFDLTIPMSTITHVTGSEAHPFYRWLAEEHQVVPGWNFHKV
LIDREGELVASWASPVRPTDRAIVGRIEALLP
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcttcgactcgattgacggcggagagatccggctcgatcatctgcgggccagg
gggccggttctcgtggtgaacacggcgtcgctctgcgggttcacgccgcagtatgacgac
ctgcaggatctttcggatcgctacgccgctcaggggctgaccgtgctggccgtgccttcc
gatgatttccggcaggaactggatgacgcgcgcgccgtccgcgacttctgcgccacgaac
ttcgacctgacgataccgatgagcaccatcacccatgtgacgggatcggaggcccatccg
ttctaccgctggctggccgaggagcatcaggtggttccgggctggaacttccacaaggtg
ctgattgaccgcgagggcgagctggtggccagctgggcctcgccggtgcggccgaccgat
cgggcgatcgtggggcggatcgaggcgcttcttccgtga

DBGET integrated database retrieval system