KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1957Help
Entry
Rsph17025_1957    CDS       T00512                                 

Definition
putative UTP-glucose-1-phosphate uridylyltransferase GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rsph17025_1957
   00052 Galactose metabolism
    Rsph17025_1957
   00500 Starch and sucrose metabolism
    Rsph17025_1957
   00520 Amino sugar and nucleotide sugar metabolism
    Rsph17025_1957
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rsph17025_1957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1997112..1998041
Genome map
AA seq 309 aa AA seqDB search
MSLKKVNTAIFPIAGMGTRFLPATKSIPKEILTLVDKPLIQYAVEEAREAGIEDFIFVTS
RGKGALEDFFDVNQPLERALRAAGKTELLATLEATNIDSGHVAYVRQHEALGLGHAVWCA
RRLVGDRPFAVILPDDMVVSDRPCLAQMMEAHAEVGGSIIATMEVAPEKASSYGILDIES
RQGALVRPRGIVEKPKAGTAPSNMAVIGRYILGPRVMRHLDRRTVGAGGEIQLTDAIAHE
LATHPGSVHGFRFSGERFDCGSKAGFLQATVALALQRADLRDEFAAFLEAIGDQHGIHRA
PRLKVAAAS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaaagaaggtcaacaccgccatcttcccgattgccgggatgggaacgcgcttc
cttcccgccacgaagtcgattcccaaggagatcctgaccctcgttgacaagccgctgatc
cagtatgcggtcgaggaggcgcgggaggccgggatcgaggatttcatcttcgtcacctcg
cgcggcaagggcgcgctcgaggacttcttcgacgtcaaccagccgctcgagcgggcgctg
cgcgccgccggcaagaccgagcttctcgccacgctcgaggcgaccaacatcgacagcggc
catgtggcctatgtccgccagcacgaggcgctcgggcttggccatgcggtctggtgcgcg
cggcgtctggtgggcgaccggcccttcgccgtgatcctgcccgacgacatggtggtctcg
gaccggccctgccttgcgcagatgatggaagctcacgccgaggtcggcggcagcatcatc
gccaccatggaagtggcccccgagaaggcctcgtcctacggcatcctcgacatcgagtcc
cgccagggcgcgctggtccgcccgcgcggcatcgtcgagaagccgaaggccggcaccgcg
ccctcgaacatggcggtgatcgggcgctacatcctcgggccgcgcgtcatgcggcacctc
gaccgcaggaccgtgggcgcgggcggcgagatccagctgaccgacgccatcgcgcacgag
ctggccacgcacccgggttcggtccacgggttccgcttcagcggcgagcggttcgactgc
ggctcgaaggcgggattcctgcaggcgacggtcgcgctggctctgcagcgcgccgatctt
cgcgacgagttcgcggccttcctcgaggcgatcggcgatcagcacggcatccacagggca
ccgcggctgaaggtggccgcggcaagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system