KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_1965Help
Entry
Rsph17025_1965    CDS       T00512                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rsph17025_1965
Enzymes [BR:rsq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rsph17025_1965
Peptidases [BR:rsq01002]
 Cysteine Peptidases
  Family C44
   Rsph17025_1965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2006847..2008721)
Genome map
AA seq 624 aa AA seqDB search
MTALAAFVTLGGDPSEAEGRVKAMLAAMPSRGPEARSVLLPGGVALGHRARHAAMGPWRL
RPGGPVLTGSLRLDNAAELQSALGLAEAADAALVLAAYDRWGLDLPLHLEGDFALVLWDP
AAGRLVGLRDRFGVCPFLYRATPQAVAVASDVEAVLGAFPACPPALDEIWIAEFLSGQPT
SAQRTIHRGINRLEPAHMLLVEKGRTEIRRYWRLEVEPRHRPDPPEALLELLERSVAARM
RGGTVGAMLSGGLDSSTLAVLASRMSEAPLPVVSMKFDACPEIDERAWIGKVHEAGRFRQ
LWLDGSEALGGTVEELLAEQGAPYLAPNLPTSRWLYRRAAETGIEILLDGHGGDEVISFG
TSRLTELAAEAQWRSLWRSTAAVSALFGSPRRELFLASASVGASSRWIRALARRLGPRAT
RDATAWRRAVHPDLVARTGLVQRVREANGVTVKGATDDIRRHIAQLTTPGYPTALEVLDR
SAAPCGISPRYPFLERRVVEHCVAQPASAKFRDGMTRALLRDAMRGLLPDEIRLRSSKTD
FSPNVRERVLRDWTESLDRLSRRDPGQIAEFVDLGVIRGGIDGLRAGEADAPALFQTLRA
IVLDEWLRAREFPAAARLDRRTPA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgctcgccgccttcgtcacgctgggcggagatccgtcggaagccgagggccgg
gtaaaggccatgctcgcggccatgccgagccgcgggcctgaggcgcggtcggtgctgctg
ccgggcggggtcgcgctgggccatcgggcgcggcacgcggccatgggcccgtggcggctg
cggccgggcggtccggtgctgaccggcagcctgaggctcgacaacgccgccgagttgcag
tccgcgctcggactggccgaggcagccgatgccgctcttgtgctggcggcctatgaccgc
tgggggctggatctgccgcttcacctcgagggcgatttcgccctcgtgctgtgggatccg
gccgcgggacggctggtcgggctgcgcgaccggttcggcgtctgccccttcctttatcgc
gccacgcctcaggcggtcgccgtcgcgtcggatgtcgaggcggtgctgggcgcctttccc
gcctgtccccccgcgctcgacgagatctggatcgccgagttcctttcgggccagcccacg
tcggcgcagcgcaccatccaccgggggatcaaccgcctggaaccggcgcacatgctgctg
gtcgagaagggccggaccgagatccgccgctactggcggctggaggtcgagccccgccac
cggcccgacccgcccgaggcgctgctcgagctgctcgagcggtcggtggcggcgcggatg
cggggcggcacggtgggcgcgatgctgagcggcgggctcgattccagcacgctcgccgtt
ctggcctcgcggatgtccgaggcgccgcttccggtggtgtcgatgaagttcgacgcctgc
cccgagatcgacgagcgcgcatggatcggcaaggttcacgaggccggccgcttccggcag
ctctggcttgatggcagcgaagctctcgggggcaccgtcgaagagcttctggccgagcag
ggcgcaccgtaccttgcgccgaacctgcccacctcgcgctggctctaccgtcgggcggcc
gagacggggatcgagatcctgctcgacgggcacggcggcgacgaggtgatctcgttcggg
acctcgcgcctgaccgaactggccgccgaggcgcagtggcggagcctctggcggtccacc
gccgccgtctcggcgctgttcggcagcccccggcgcgagctttttctggcatcggcctcg
gtgggtgcctcgtcgcgctggatccgggcgctggcccgccggttggggcccagagccacc
cgcgatgcgacggcctggaggcgggcggttcatcccgatctggtggcgcggaccggcctc
gtccagcgcgtgcgcgaggcgaacggcgtgacggtgaagggtgcgacggacgacatccgg
cgccacatcgcgcaactgacgacaccgggctatcccaccgcgctcgaggtgctcgaccgt
tccgcagccccgtgcgggatttcgccgcgctatccgttcctcgagcggcgggtggtcgag
cattgcgtggcgcagcccgcctcggccaagttccgcgacggcatgacccgagccctgctg
cgcgacgcgatgcgcggcctgctgcccgacgagatccgcctgcggagcagcaagaccgac
ttcagccccaacgtgcgcgagcgtgtgctgagggactggaccgagagccttgaccggctg
tcccggcgcgatcccggccagatcgccgaattcgtggatcttggcgtcatccgcggcggc
atcgacgggcttcgcgcgggcgaggccgatgcccccgcgctcttccagaccctgcgcgcg
attgtgctggacgaatggcttcgggcccgggagttccccgccgccgcccgactcgacaga
aggacacctgcatga

DBGET integrated database retrieval system