KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2178Help
Entry
Rsph17025_2178    CDS       T00512                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00521  Streptomycin biosynthesis
rsq00523  Polyketide sugar unit biosynthesis
rsq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rsph17025_2178
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rsph17025_2178
Enzymes [BR:rsq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rsph17025_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABP71068
JGI: Rsph170252178
UniProt: A4WUK4
Position
2208273..2208806
Genome map
AA seq 177 aa AA seqDB search
MRFIPTTLKDAVLIEAEPREDHRGWFERTFCEEEMAKAGLATRFVQHNSSYNHAVGTLRG
MHYQRSPHAEVKVITCTRGRIHDVIIDLRPDSPTYMKWEGFDLRAGDHRQLYIPEGFAHG
YLTLEDATAVSYLVSTAYTPGAEGGVRWDDPTFGIAWAGGVSVISEKDAAWPDYTPG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcattccgacgacgctgaaggatgccgtcctcatcgaggcggagccgagagag
gatcaccggggctggttcgagcgaaccttctgcgaggaggagatggcgaaggccggactt
gccacccgtttcgtccagcacaacagctcctacaaccatgcggtcggcacgttgcgcggc
atgcactaccagcgcagcccgcacgccgaggtgaaggtgatcacctgcacgcgcgggcgc
attcacgacgtgatcatcgacctgcgcccggattcgcccacctacatgaaatgggaaggg
ttcgacctgcgcgccggggaccaccgccagctctatatccccgaaggcttcgcgcacggc
tatctgacgctcgaggatgcgacggcggtctcctacctcgtctcgaccgcatacacgccg
ggcgccgagggcggcgtgcgctgggatgatccgaccttcgggatcgcatgggccggcggg
gtctcggtgatctcggaaaaggatgcggcctggccggactacacgccgggatag

DBGET integrated database retrieval system