KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2296Help
Entry
Rsph17025_2296    CDS       T00512                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00071  Fatty acid degradation
rsq00280  Valine, leucine and isoleucine degradation
rsq00281  Geraniol degradation
rsq00310  Lysine degradation
rsq00362  Benzoate degradation
rsq00380  Tryptophan metabolism
rsq00410  beta-Alanine metabolism
rsq00640  Propanoate metabolism
rsq00650  Butanoate metabolism
rsq00903  Limonene and pinene degradation
rsq00930  Caprolactam degradation
rsq01040  Biosynthesis of unsaturated fatty acids
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01200  Carbon metabolism
rsq01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rsph17025_2296
   00650 Butanoate metabolism
    Rsph17025_2296
  Lipid metabolism
   00071 Fatty acid degradation
    Rsph17025_2296
   01040 Biosynthesis of unsaturated fatty acids
    Rsph17025_2296
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rsph17025_2296
   00310 Lysine degradation
    Rsph17025_2296
   00380 Tryptophan metabolism
    Rsph17025_2296
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rsph17025_2296
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rsph17025_2296
   00281 Geraniol degradation
    Rsph17025_2296
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rsph17025_2296
   00930 Caprolactam degradation
    Rsph17025_2296
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Rsph17025_2296
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rsph17025_2296
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Rsph17025_2296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_binding_8 UDPG_MGDP_dh_N FAD_binding_3 2-Hacid_dh_C DAO Pyr_redox_2 DFP XdhC_C F420_oxidored Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ABP71185
JGI: Rsph170252296
UniProt: A4WUX1
Position
2333474..2335675
Genome map
AA seq 733 aa AA seqDB search
MTDFTSKTDADGVCTITWDVPGKSMNVMSMDGFAELDGLIAAALADPGVKGVILTSGKKD
FAGGMDLNVIARMKAEGGDDPARAVFEGVMQMHAVLRRIERAGMDPKTHKGGKPIVAALP
GTALGIGLELPLACHRIIAADNPKAKIGLPEIMVGIFPGGGGTTRLVRKLGAMMAAPLLL
EGKLNDPRGAKAVGVVDEVVPADELLARAKEWVLSATDADLVKPWEARGYKMPGGTPYHP
GGFMTFVGASAMVMGKTMGVYPAAKALLSAVYEGALVPFDTALKIEARWFTHVLMNPSSS
AMIRSLFINKEALEKGAVRPALPDQSVRKLGVIGAGMMGAGIAHVAASAGIEVVLIDSTQ
EAADRGRAHSEGVLDKGMKRGKITAGKKAEVLARIHATTDYGTLAGCDLIVEAVFEDPSV
KAEVTQKVEAVVGPECIFATNTSTLPISGLAKASRDPAQFIGIHFFSPVDKMLLVEIIRG
KQTGDRAVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYLNEGIRMVAEGVQPALIENA
ARLVGMPLGPLQLVDETSIDLGVKIAKATRAAMGDAYPDSAVDEVIFRLADEGRMGRKAK
AGFYAYDEAGKRQGLWSGLADRWPVAPLQPELTEVQHRLLFAQVLEAVRALEQGVLTDIR
EGDVGAILGWGFAPWSGGPFSWLDMIGAARAVELCEDLAGRHGARFAPPQLLVEMARQGE
SFYGRFAPRARAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcacgagcaagaccgacgccgacggcgtctgcaccatcacctgggacgtg
ccgggcaagtcgatgaacgtcatgtcgatggacggctttgccgaactcgacgggctgatc
gccgcggccctcgccgatccgggcgtgaagggagtgatcctcacctcgggcaagaaggac
tttgccggggggatggatctcaacgtcatcgcccgcatgaaggccgaaggcggcgacgat
ccggccagggctgtgttcgaaggcgtgatgcagatgcacgccgtcctgcgccggatcgag
cgcgcgggcatggatcccaagacccacaagggcggcaagcccatcgtggcggcgctgccc
ggcaccgcgctcggcatcgggctcgaactgccgctggcctgccaccgcatcatcgccgcc
gacaatccgaaggcgaagatcggcctgcccgagatcatggtggggatcttccccggcggc
gggggcacgacacgacttgtccgcaagctgggcgccatgatggccgcgccgctgctgctc
gagggcaagctgaacgatcccaggggcgcgaaggccgtgggcgtggtggatgaggtggtg
cccgcggacgagcttctcgcgcgggcgaaggaatgggtgctgtcggcaacggacgccgac
ctcgtgaagccctgggaggccaggggctacaagatgcccggtggcacgccctaccatccc
ggcggcttcatgaccttcgtgggcgcctcggccatggtgatgggcaagaccatgggcgtc
tatccggcggcgaaggcgctgctgtcggcggtctatgagggtgccctggtgcccttcgac
acggcgctgaagatcgaggcccgctggttcacccatgtgctgatgaacccctcctcctcg
gcgatgatccggtcgctcttcatcaacaaggaggcgctggagaagggcgccgtccgccct
gccctgcccgaccagtcggtgaggaagctgggcgtgatcggcgcgggcatgatgggcgcg
ggcatcgcccatgtcgcggccagcgccggcatcgaggtggtgctgatcgactcgacgcag
gaggccgccgaccgcgggcgggcgcattcggaaggggtgctcgacaaggggatgaagcgg
ggcaagatcacggccgggaagaaggccgaggtgctggcccgcattcatgcgacgaccgac
tacggaacgctcgcgggctgcgacctgatcgtcgaggcggtgttcgaggatccgtcggtg
aaggccgaggtcacgcagaaggtcgaggcagtggtggggccggagtgcatcttcgccacc
aacacctcgaccctgccgatctcgggactcgccaaggccagccgcgatccggcgcagttc
atcggcatccatttcttctcgccggtggacaagatgctgctggtcgagatcatccgcggc
aagcagactggcgaccgggccgtggccaaggcgctcgacttcgtgcgccagatccgcaag
acgccgatcgtggtgaacgacgcccgcttcttctacgccaaccgctgcatcatcccctat
ctcaacgaggggatccgcatggtggccgagggcgtgcagccggccctcatcgagaatgcg
gcgcggctcgtggggatgccgctcggaccgctgcaactggtggacgagacctcgatcgac
ctcggcgtgaagatcgccaaggccacgcgcgccgcgatgggcgatgcctacccggattcg
gcggtggacgaggtgatcttccggctggccgacgagggccgcatggggcgcaaggcaaag
gcgggcttctacgcctatgacgaggcgggcaagcggcagggtctctggagcgggctcgca
gaccgctggccggtcgcgccactgcagcccgagctgaccgaggtgcagcatcgcctcctg
tttgcgcaggtgctcgaagcggtgcgtgcgctcgaacagggcgtgctcaccgacatccgc
gagggggatgtgggggcgatcctcggctggggctttgcgccctggtcgggcggccccttc
agctggctcgacatgatcggcgcggcgcgggcggtcgagctgtgcgaggaccttgcaggc
cggcacggcgcacgctttgcacccccgcaactgctggtcgagatggcccggcagggcgag
agcttctacggccggttcgcgccccgcgcccgcgcggcctga

DBGET integrated database retrieval system