KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2398Help
Entry
Rsph17025_2398    CDS       T00512                                 

Definition
L-fuculose-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rsph17025_2398
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Rsph17025_2398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2446746..2447390)
Genome map
AA seq 214 aa AA seqDB search
MEADERTKREAIIAACLEMNRSGLNQGTSGNISVRHGEGLLITPTAIAYERLQPEDIVFL
AMDGTATGRHRPSSEWRFHRDILAARPDAHAVVHAHPPACTTLAILNREIPAVHYMIAAA
GGPTVRVAPYAIYGSEELSHHAVAALEGRLACLLEHHGMIAIGPSLARTMWTAVEVETLA
RQYLGCLQVGEVRILSDEQIAAVVEKFAGYGLQV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggacgaacggaccaagcgcgaggcgatcatcgcggcctgtctcgagatgaac
cgctcgggcctcaatcaggggacgtcgggcaacatctcggtgcggcatggcgaggggctg
ctcatcactcccacggccatcgcctacgagcggcttcagcccgaggatatcgtctttctc
gcgatggacggcacggccaccgggcggcaccggccctcgagcgagtggcgctttcaccgc
gacatcctggccgcgcggcccgatgcccatgcggtcgtccatgcccatcccccggcctgc
accacgctggcgatcctgaaccgcgagatccccgccgtgcattacatgatcgcggccgcg
ggcgggcccacggtccgcgtggcgccctatgcgatctacggttcggaagagctgtcccat
catgcggtggccgcgctcgaggggcggctggcctgcctgctcgagcatcacgggatgatc
gccatcgggccgtcgctcgcgcggacgatgtggacggcggtcgaggtcgagacgctggcc
cggcagtatctcggctgcctgcaggtcggcgaggtgcggatcctctcggatgagcagatc
gcggcggtggtcgagaagttcgcgggctacgggctgcaggtctga

DBGET integrated database retrieval system