KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2398Help
Entry
Rsph17025_2398    CDS       T00512                                 

Definition
(GenBank) L-fuculose-phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00051  Fructose and mannose metabolism
rsq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rsph17025_2398
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Rsph17025_2398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABP71287
JGI: Rsph170252398
UniProt: A4WV73
Position
complement(2446746..2447390)
Genome map
AA seq 214 aa AA seqDB search
MEADERTKREAIIAACLEMNRSGLNQGTSGNISVRHGEGLLITPTAIAYERLQPEDIVFL
AMDGTATGRHRPSSEWRFHRDILAARPDAHAVVHAHPPACTTLAILNREIPAVHYMIAAA
GGPTVRVAPYAIYGSEELSHHAVAALEGRLACLLEHHGMIAIGPSLARTMWTAVEVETLA
RQYLGCLQVGEVRILSDEQIAAVVEKFAGYGLQV
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggacgaacggaccaagcgcgaggcgatcatcgcggcctgtctcgagatgaac
cgctcgggcctcaatcaggggacgtcgggcaacatctcggtgcggcatggcgaggggctg
ctcatcactcccacggccatcgcctacgagcggcttcagcccgaggatatcgtctttctc
gcgatggacggcacggccaccgggcggcaccggccctcgagcgagtggcgctttcaccgc
gacatcctggccgcgcggcccgatgcccatgcggtcgtccatgcccatcccccggcctgc
accacgctggcgatcctgaaccgcgagatccccgccgtgcattacatgatcgcggccgcg
ggcgggcccacggtccgcgtggcgccctatgcgatctacggttcggaagagctgtcccat
catgcggtggccgcgctcgaggggcggctggcctgcctgctcgagcatcacgggatgatc
gccatcgggccgtcgctcgcgcggacgatgtggacggcggtcgaggtcgagacgctggcc
cggcagtatctcggctgcctgcaggtcggcgaggtgcggatcctctcggatgagcagatc
gcggcggtggtcgagaagttcgcgggctacgggctgcaggtctga

DBGET integrated database retrieval system