KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2440Help
Entry
Rsph17025_2440    CDS       T00512                                 

Definition
phosphatidylethanolamine N-methyltransferase (EC:2.1.1.17)
Orthology
K00570  
phosphatidylethanolamine/phosphatidyl-N-methylethanolamine N-methyltransferase [EC:2.1.1.17 2.1.1.71]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, PE => PC
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rsq00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2492180..2492794
Genome map
AA seq 204 aa AA seqDB search
MELDAVSRSYKRWAPIYDFSFGKVSESPRRRTATHVNARGGRVLEVGVGTGLSLPLYSRR
VEVTGIDFSHEMLAKAREKVEELGLTPVKQLRQMDAREIDFPDETFDTVVAMFLVSVVPE
PERVVSEMARVCKSGGEVVIVNHFAREKGPLAAVEKALARFENTLGWHSDFSIERVTGDP
RLEVVEQAPMGPGGLFTFLRFRRR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggaacttgacgcggtgagccggagctacaagcggtgggcgccgatctacgacttcagc
ttcggcaaggtcagcgagagtccgcgccgccgcacggcgacgcatgtgaacgcccgtggc
ggccgcgtgctcgaggtgggcgtgggcacgggcctgtcgctgccgctctacagccgccgc
gtcgaggtgaccggcatcgacttctcgcacgagatgctggccaaggcgcgcgagaaggtc
gaggaactcggcctgacgccggtgaagcagcttcgccagatggacgcgcgcgagatcgac
ttccccgatgagaccttcgacacggtggtggcgatgttcctcgtctcggtggtgcccgag
cccgaacgtgtcgtctccgagatggcccgcgtctgcaagtccggcggcgaggtcgtcatc
gtgaaccatttcgcccgcgaaaagggcccgcttgccgccgtcgaaaaggcgctcgcgcgg
ttcgagaacacgctgggctggcattcggacttttccatcgagcgggtcacgggcgatccg
cgcctcgaggtggtcgaacaggccccgatggggccgggtggcctcttcacattcctgcgc
ttccggcgccgctga

DBGET integrated database retrieval system