KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2471Help
Entry
Rsph17025_2471    CDS       T00512                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00900  Terpenoid backbone biosynthesis
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01130  Biosynthesis of antibiotics
Module
rsq_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rsph17025_2471
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rsph17025_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABP71359
JGI: Rsph170252471
UniProt: A4WVE5
Position
complement(2519383..2520219)
Genome map
AA seq 278 aa AA seqDB search
MTEAFARAKINLTLHVTGQRPDGYHLLDSLVVFADVGDRVRTEPAEALSLAITGPQAVNL
PVSDDNLVLRAARAMGGQGARITLEKHLPVASGIGGGSADAAATLKALAELWQRPLPEAA
AVLRLGADVPVCLEGRAVRMAGVGEILEPLAGPLPPAWLVLANPGVSVPTPPVFKALARR
DNPPMPERLPDWGSADELAAFLAAMRNDLEAPAIALAPEVAETRAALAAEPGCLIARMSG
SGATCFGLFAEERPARAAAEALRAAHPGWWIEPARMAG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagcctttgcccgcgccaagatcaacctgaccctgcatgtcaccggccagcgg
ccggacggctaccatctccttgattcgcttgtggtcttcgccgacgtgggcgaccgggtg
cggaccgagccggccgaggcgctcagcctggccatcacgggtccacaggccgtgaacctg
ccggtctcggacgacaatctcgtgctgcgtgccgcgcgcgcgatgggcgggcagggcgcg
cggatcacgctcgaaaagcacctgccggtggcctcggggattggcggagggtcggccgat
gccgccgcgacgctgaaggcgctggccgagctttggcaacggccgctgcccgaggccgct
gcggtgctccggctcggggcggatgtgcccgtctgcctcgaggggcgggccgtgcgcatg
gccggcgtgggcgagatcctcgagccgctcgcggggccgcttccgccggcctggctggtg
ctcgccaatcccggcgtttcggtgccgacgccgcccgtcttcaaggccctggcccgccgt
gacaacccaccgatgcccgagcgacttcccgactggggctcggccgacgagctcgcggcc
ttcctcgccgccatgcgcaacgaccttgaggcgcccgccatcgcgctggcgcccgaggtc
gccgagacccgtgccgcgctggcggccgagcccggctgcctcatcgcgcgcatgtccggg
tccggcgccacctgctttggcctctttgccgaggagcgcccggcccgcgcggcggccgag
gcgctgcgggccgctcatccgggctggtggatcgagcccgcgcgcatggcgggctga

DBGET integrated database retrieval system