KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2494Help
Entry
Rsph17025_2494    CDS       T00512                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17025_2494
  Amino acid metabolism
   00300 Lysine biosynthesis
    Rsph17025_2494
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Rsph17025_2494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2542506..2543777
Genome map
AA seq 423 aa AA seqDB search
MKDSRLIAEVESRRADLVALAQELVRIPTLNPPGRNYREICEMLAARLAPAFDVERIRAE
GAPGDSEAHPRWNLIARRAGARPGDCVHFNSHHDVVEVGHGWTRDPFGAEVEGDRLYGRG
ACDMKGGLAASVIAAEAFLAVCPDFAGRIEISATADEESGGFGGVAYLAGQGRFAHVQHV
LIPEPLHKDRICLGHRGVWWAEVETRGRIAHGSMPFLGESAIRHMGALLSEIEERLYPLL
ARRTTAMPVTPEGARQSTLNINSIHGGEPEPEPGYTGLPAPCVADRCRIVIDRRFLIEED
LAEVKAELHALAARLAETRPGFAFEIRDLFEVQPTMTDREAPVVRSTAAAIERVLARQAD
YVVSPGTYDQKHIDRIGKLKNCIAYGPGLLHLAHQPDEWVGIQDMLDSAKVMALVLADLL
DRP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacagccgcctgatcgccgaagtcgaatcccgccgcgccgatctggtcgctctg
gcgcaggaactggtgcgcatccccaccctcaacccgcccgggcgcaactaccgcgagatc
tgcgagatgctggccgcgcggctcgcaccggccttcgacgtcgaacggatccgcgccgag
ggcgcgccgggcgattccgaggcccatccgcgctggaacctgatcgcgcggcgggcgggg
gcgcggccgggcgactgcgtgcatttcaactcgcaccatgacgtggtcgaggtgggccac
ggctggacgcgcgacccgttcggggccgaggtcgagggggaccggctttacggccgtggc
gcctgcgacatgaagggcggcctcgccgcctcggtgatcgcggccgaggccttcctcgcc
gtctgcccggactttgcgggccgcatcgagatttcggccaccgccgacgaggagtcgggc
ggctttggcggcgtggcttacctcgccgggcagggccgctttgcccatgtccagcatgtg
ctgatccccgaaccgctgcacaaggaccggatctgcctcggccatcgcggcgtctggtgg
gccgaggtcgagaccaggggccggatcgcccacggctcgatgccctttctgggagagagc
gcgatccggcacatgggggcgctgctctccgagatcgaggagcggctctatccgctgctc
gcccgccgcaccaccgccatgccggtaacccccgagggcgcgcggcaatcgacgctcaac
atcaactcgatccacggcggcgagcccgagcccgagcccggctacaccggcctgcccgcc
ccctgcgtggccgaccgttgccgcatcgtgatcgaccgccgcttcctgatcgaggaggat
ctggccgaggtgaaggccgagttgcacgccctcgccgcccggctggccgagacccgcccc
ggcttcgccttcgagatccgggacctcttcgaggtgcagcccaccatgaccgaccgcgaa
gcccccgtggtgcgctcgaccgccgccgccatcgagcgggttctggcgcggcaggcggat
tatgtcgtttcgcccggcacctacgatcagaagcacatcgaccggatcggcaagctgaag
aactgcatcgcctacgggccggggctgctgcatctggcgcaccagcccgacgagtgggtg
ggcatccaggacatgctggacagcgccaaggtcatggcgctggtgctggccgacctgctc
gaccgtccgtga

DBGET integrated database retrieval system