KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2578Help
Entry
Rsph17025_2578    CDS       T00512                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rsq00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2618347..2618883)
Genome map
AA seq 178 aa AA seqDB search
MPFAGGFPEGTVREAIAAVAKAFGANFQASRLYLTPFFPAGDAPDFVNAAMTLHLSDEVG
PEAVLRRLHEVEADFGRSRSRRWASRTLDLDLIALGDSVWPDADTQGLWRNLPPEDQARR
VPDGLILPHPRLQDRAFVLVPLADVAPEWRHPLLGRTVLEMLAALPAADRAAVVPLEA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgccgtttgcgggagggttccccgagggaaccgttcgcgaggcgattgctgcggtcgca
aaggcgtttggtgccaattttcaagccagcagactctatcttacccctttttttcctgca
ggtgacgcaccggattttgtcaatgcggccatgacactgcacctatcggatgaagtgggt
ccagaggcggttctgcgccgcctgcatgaggttgaggcggatttcggccgatcgcggtcg
agacggtgggcgagccgcaccctcgacctcgatctgatcgcgctgggtgattcggtctgg
cccgacgccgacacgcaagggctgtggagaaacctgccccccgaagatcaggcccggcgg
gtgcccgatggcctgatcctcccccatccccggcttcaggatcgcgccttcgtcctcgtg
ccgctcgccgatgtggcgccggaatggcgtcatccgctgctcggccgcaccgtcctcgag
atgctggcggcgcttcccgcggccgaccgggcggcggtggtgccgctcgaggcctga

DBGET integrated database retrieval system