KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2751Help
Entry
Rsph17025_2751    CDS       T00512                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rsph17025_2751
   00052 Galactose metabolism
    Rsph17025_2751
   00500 Starch and sucrose metabolism
    Rsph17025_2751
   00520 Amino sugar and nucleotide sugar metabolism
    Rsph17025_2751
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Rsph17025_2751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2792244..2793137)
Genome map
AA seq 297 aa AA seqDB search
MTTKKVTKAVFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTS
RGKSALEDYFDNAPELEAALKKPGKEHLLEVLESTNMESGAIAYVRQHKALGLGHAVWCA
RRLIGDEPFAVMLPDDVIAAEKPCLQQMVEAYEQTGGNMVAAMEVPPEKASAYGVLSVEE
DMGSIVKVNGMVEKPKANPPSNLAVIGRYILTPKVLNNLNRKKEGAGGEIQLTDAIAEEI
EGSGKVYGFRFRGQRYDCGSKAGFLQATVAFGLARPELRDEFSGYLNDMMALERAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaagaaggttaccaaagccgttttcccggtcgcagggcttgggacgcgcttt
ctgccggcgaccaagtcgatcccgaaagagatcatgacgctggttgaccgccccctgatc
caatatgcgatcgacgaggcgcgggcggccggcatcaaggaattcattttcgtcacctcg
cgcggcaagagcgcgctcgaggattatttcgacaatgccccggaactcgaggcggcgctg
aagaagccgggcaaggagcatttgctcgaggtgctggaaagcaccaacatggaaagtggc
gccatcgcctacgtccgccagcacaaggccctgggcctcggccacgccgtctggtgcgcc
cggcggctgatcggagacgagcccttcgccgtgatgctgcccgacgacgtgatcgcggcc
gagaagccgtgcctccagcaaatggtggaggcgtatgagcagaccggcggcaacatggtg
gccgcgatggaggtgccgcccgagaaagcctcggcctatggcgtgctctcggtcgaggaa
gacatgggctcgatcgtcaaggtcaacgggatggtcgagaaaccgaaggcaaatccgcct
tcgaacctcgcggtgatcgggcgttacatcctgacgccaaaggtgctgaacaacctgaac
cgcaagaaggaaggtgcaggcggcgaaatccagctgacagacgccatcgccgaggagatc
gagggttcgggcaaggtgtatggcttccggttccgcggccagcggtatgattgcggctcg
aaggccggcttcctgcaggcgacggtggcctttggactcgcccgacccgagttacgcgac
gaattctcgggatacctgaacgacatgatggctctcgagagggcggcccagtaa

DBGET integrated database retrieval system