KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2965Help
Entry
Rsph17025_2965    CDS       T00512                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00260  Glycine, serine and threonine metabolism
rsq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01130  Biosynthesis of antibiotics
rsq01230  Biosynthesis of amino acids
Module
rsq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17025_2965
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17025_2965
Enzymes [BR:rsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rsph17025_2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP L27
Motif
Other DBs
NCBI-ProteinID: ABP71851
JGI: Rsph170252965
UniProt: A4WWT7
Position
complement(3028897..3030102)
Genome map
AA seq 401 aa AA seqDB search
MSAYMKSHPTREGFFGPYGGAMLPPPLEPHFAAIREAYDRISKSADFINELRYIRKHFQG
RPTPVSYLKNLSAICGGAQIYAKREDLNHTGAHKLNHCMAEGLLARFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVGFGGRSLKEAVDSC
FQSYLSQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQFLELTGELPDMVAACVGG
GSNAMGIFSGFIDDDVALYGVEPCGTSSKLGEHAATITYGEDGDIHGFRTMVLKDAEGNP
APVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDKEALAAFYALSRHEGIIPALESAHA
VAFAMREAKNHPGESILINLSGRGDKDIDYVTETHGFGDSL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctacatgaaatcccatcccacgcgcgaaggcttcttcggcccctacggcggc
gccatgctgcccccgccgctcgagccgcatttcgcagcgatccgcgaggcctacgaccgg
atctcgaaatcggccgacttcattaacgagctgcgctacatccgcaagcatttccagggc
cggccgacgcccgtttcctacctcaagaacctgtccgcgatctgcggcggcgcgcagatc
tacgccaagcgcgaggatctgaaccacaccggcgcccacaagctgaaccactgcatggcc
gaggggcttctggcgcgcttcatgggcaagacgaagctgatggccgagacgggggccggc
cagcatggcgtggcgctggcgacggccgcggcctatttcggcatggaatgcgagatccac
atgggcgagatcgacatcgccaaggaggcgccgaacgtcacccgcatgaagcttctgggc
gcgaccgtggtgccggtgggctttggcggccgctcgttgaaagaggcggtggacagctgc
ttccagagctacctttcgcaggcggacacggcgctcttcgccatcggctcggtcgtgggg
ccgcatcccttcccgatgatggtgcgcgacttccagcatgtcgtgggcgtcgaggcgcgc
gagcagttcctcgagctgaccggagagctgcccgacatggtggcggcctgcgtcggcggc
gggtcgaacgcgatggggatcttctcgggcttcatcgatgacgatgtggcgctttacggg
gtggagccctgcggcacctcgtcaaagctgggcgaacacgcggcgaccatcacctatggc
gaggatggcgacatccacggcttccgcacgatggtgctgaaggatgccgaagggaacccg
gcgccggtgcataccgtggcctcgggcctcgactatcctggcgtcgggccggagcacgcc
ttcctgcaccgctcgggccgcgtgacctacaccggcgccgacgacaaggaggcgctggcg
gccttctatgccctctcgcggcatgaaggcatcatccccgcgctggaaagcgcccatgcc
gtcgcgttcgccatgcgcgaggcgaagaaccatccgggcgagtcgatcctgatcaacctc
tcgggccggggcgacaaggacatcgactatgtgaccgagacccacggtttcggcgacagc
ctgtaa

DBGET integrated database retrieval system