KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2965Help
Entry
Rsph17025_2965    CDS       T00512                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17025_2965
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17025_2965
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17025_2965
Enzymes [BR:rsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rsph17025_2965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3028897..3030102)
Genome map
AA seq 401 aa AA seqDB search
MSAYMKSHPTREGFFGPYGGAMLPPPLEPHFAAIREAYDRISKSADFINELRYIRKHFQG
RPTPVSYLKNLSAICGGAQIYAKREDLNHTGAHKLNHCMAEGLLARFMGKTKLMAETGAG
QHGVALATAAAYFGMECEIHMGEIDIAKEAPNVTRMKLLGATVVPVGFGGRSLKEAVDSC
FQSYLSQADTALFAIGSVVGPHPFPMMVRDFQHVVGVEAREQFLELTGELPDMVAACVGG
GSNAMGIFSGFIDDDVALYGVEPCGTSSKLGEHAATITYGEDGDIHGFRTMVLKDAEGNP
APVHTVASGLDYPGVGPEHAFLHRSGRVTYTGADDKEALAAFYALSRHEGIIPALESAHA
VAFAMREAKNHPGESILINLSGRGDKDIDYVTETHGFGDSL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctacatgaaatcccatcccacgcgcgaaggcttcttcggcccctacggcggc
gccatgctgcccccgccgctcgagccgcatttcgcagcgatccgcgaggcctacgaccgg
atctcgaaatcggccgacttcattaacgagctgcgctacatccgcaagcatttccagggc
cggccgacgcccgtttcctacctcaagaacctgtccgcgatctgcggcggcgcgcagatc
tacgccaagcgcgaggatctgaaccacaccggcgcccacaagctgaaccactgcatggcc
gaggggcttctggcgcgcttcatgggcaagacgaagctgatggccgagacgggggccggc
cagcatggcgtggcgctggcgacggccgcggcctatttcggcatggaatgcgagatccac
atgggcgagatcgacatcgccaaggaggcgccgaacgtcacccgcatgaagcttctgggc
gcgaccgtggtgccggtgggctttggcggccgctcgttgaaagaggcggtggacagctgc
ttccagagctacctttcgcaggcggacacggcgctcttcgccatcggctcggtcgtgggg
ccgcatcccttcccgatgatggtgcgcgacttccagcatgtcgtgggcgtcgaggcgcgc
gagcagttcctcgagctgaccggagagctgcccgacatggtggcggcctgcgtcggcggc
gggtcgaacgcgatggggatcttctcgggcttcatcgatgacgatgtggcgctttacggg
gtggagccctgcggcacctcgtcaaagctgggcgaacacgcggcgaccatcacctatggc
gaggatggcgacatccacggcttccgcacgatggtgctgaaggatgccgaagggaacccg
gcgccggtgcataccgtggcctcgggcctcgactatcctggcgtcgggccggagcacgcc
ttcctgcaccgctcgggccgcgtgacctacaccggcgccgacgacaaggaggcgctggcg
gccttctatgccctctcgcggcatgaaggcatcatccccgcgctggaaagcgcccatgcc
gtcgcgttcgccatgcgcgaggcgaagaaccatccgggcgagtcgatcctgatcaacctc
tcgggccggggcgacaaggacatcgactatgtgaccgagacccacggtttcggcgacagc
ctgtaa

DBGET integrated database retrieval system