KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3079Help
Entry
Rsph17025_3079    CDS       T00512                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00620  Pyruvate metabolism
rsq00630  Glyoxylate and dicarboxylate metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rsph17025_3079
   00630 Glyoxylate and dicarboxylate metabolism
    Rsph17025_3079
Enzymes [BR:rsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Rsph17025_3079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3355
Motif
Other DBs
NCBI-ProteinID: ABP71963
JGI: Rsph170253079
UniProt: A4WX49
Position
complement(3148452..3150611)
Genome map
AA seq 719 aa AA seqDB search
MTDRIEKHGLQVDTRLAEFVAREALPGTGVGEDAFWGGLARMVRELGPGNRALLDRRADL
QARIDAWHRDRRGQRTSLEDYTAFLRDIGYLLPEGPDFTIETGNVDPEIAEVAGPQLVVP
VMNARYALNAANARWGSLYDALYGTDALGDAPPAGEFDAEQGARVIAWGRQFLDEVAPLA
EGSHAEVESYRIANGALVPALKEPAQFAGYAGPAGAPSAILLANNGLHLILDIDRGHRIG
ATDRAGVADIRMESALSAIMDCEDSVAAVDGEDKALAYGNWLGLMRGDLREAISKAGRMF
VRELAPDLSFTAPDGGTITLKGRALMLVRNVGHLMTTPAVLDEAGEEIFEGMLDAFATTL
CAIHDLRKTAGPRNSVTGSVYVVKPKMHGPEEVAFADEIFTRVEEALGLPRYSVKLGIMD
EERRTSVNLKECIRAARHRVAFINTGFLDRTGDEIVTGMEAGPMVKKGDMKASRWIASYE
DRNVDIGLACGLRGRAQIGKGMWAMPDRMAEMLANKIAHPRAGANCAWVPSPTAATLHAT
HYHRVDVKARQEEIAAGGPRGSLADLLTLPVAEGVNWSDAELRQEIENNAQGILGYVVRW
VDQGVGCSKVPDINDVGLMEDRATCRISSQALVNWLHHGVVSEEQVLAALKKMAAVVDAQ
NAGDPAYRPMAPDFDGAAFQAACDLVFKGREQPSGYTEPVLHDRRLQVKAERTPQVSRA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgaccggatcgagaagcacgggttgcaggtggacacgcgccttgccgagttcgtg
gcgcgcgaggccctgccgggcacgggtgtcggcgaggacgccttctggggggggctcgcc
cggatggtgcgcgaactggggcccggaaaccgcgcgcttcttgaccgtcgcgccgatctg
caggcgcggatcgatgcctggcatcgggatcggcgcggccagcgcacgagcctcgaggac
tacacggccttcctgcgcgacatcggctatctgctgccggagggaccggatttcacgatc
gagaccggcaacgtcgatcccgagatcgccgaggttgcaggtccgcagctggtcgtgccg
gtgatgaacgcccgctacgcgctgaatgcggccaacgcgcgctggggctcgctctatgat
gcgctctacggtacggacgcgcttggggatgcgccgccggccggtgagttcgatgccgag
cagggcgcgcgcgtgatcgcctgggggcggcagttcctggacgaggtggcgccgctcgca
gagggcagtcatgccgaggtcgagagctaccggatcgcgaacggggctctcgtgcccgcg
ctgaaggagcctgcgcaattcgccggctacgcggggccggccggggcaccgagcgcgatc
ctcctcgcgaacaacgggctgcatctgatcctcgacatcgaccgggggcaccggatcggg
gcgacggaccgcgcgggtgtggccgacatccggatggagtccgcgctgtcggccatcatg
gattgcgaggattccgtcgcggccgtcgatggcgaggacaaggcactggcctacggcaac
tggctgggcctgatgcgcggcgacctgcgcgaggcgatctcgaaggccgggcgcatgttc
gtgcgggagctggcgccggacctgtccttcacggcgcccgatggcggcacgatcacgctc
aagggccgggcgctgatgctggtgcggaacgtgggccatctgatgaccacgcccgccgtg
ctggacgaggcgggcgaggagatcttcgaggggatgctcgacgccttcgccacgaccctc
tgcgccatccatgacctgcgcaagaccgcagggccgcgaaattcggtgactggctctgtc
tatgtggtgaagcccaagatgcacgggcctgaggaagtggccttcgccgacgagatcttc
acccgggtcgaggaggcgctcggcctgccgcgctacagcgtcaagctcggcatcatggat
gaggaacgccggacgtcggtcaacctcaaggaatgcatccgcgcggcgaggcaccgggtg
gccttcatcaacacgggcttcctcgaccggaccggggacgagatcgtgaccggcatggag
gcgggcccgatggtgaagaagggcgacatgaaggcctcgcgctggatcgcgtcctacgag
gaccggaacgtggacatcggccttgcctgcgggctgcgcggccgggcgcagatcggcaag
ggcatgtgggccatgcccgaccggatggccgagatgctcgcgaacaagatcgcgcatccc
cgtgcgggcgccaattgcgcctgggtgccctcgcccacggcggcgacgctccacgccacc
cactatcaccgcgtggatgtgaaggcgcggcaagaggagatcgcggccggtggcccccgc
ggcagcctcgccgacctgctcaccctgcccgtggccgagggcgtgaactggtcggatgcc
gagctgcggcaggagatcgagaacaacgcccagggcatcctgggctatgtcgtccgctgg
gtcgatcagggcgtgggctgctcgaaagtgcccgacatcaacgacgtgggcctgatggag
gaccgcgcgacctgccggatctcgagccaggcgctggtgaactggctgcaccacggggtt
gtctcggaagagcaggtactggcggcgctgaaaaagatggcggccgtcgtggatgcgcag
aacgccggagaccccgcctatcgccccatggcgccggatttcgacggtgcggccttccag
gcggcctgcgatctggtcttcaagggccgcgagcagccttcgggctacaccgagcccgtg
cttcacgaccgccgcctccaggtgaaggccgagcgcacgccgcaggtgagccgcgcctga

DBGET integrated database retrieval system