KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3097Help
Entry
Rsph17025_3097    CDS       T00512                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01130  Biosynthesis of antibiotics
rsq01230  Biosynthesis of amino acids
Module
rsq_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17025_3097
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rsph17025_3097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh PIG-X
Motif
Other DBs
NCBI-ProteinID: ABP71981
JGI: Rsph170253097
UniProt: A4WX67
Position
complement(3173522..3174334)
Genome map
AA seq 270 aa AA seqDB search
MSTILDRIKAYKLEEIEARKAERPLVAVEDAARAAPAPRGFARALSAAAATGYGLIAEIK
KASPSKGLIREDFDVPALARAYEAGGATCLSVLTDGPSFQGADEFLRQAHDAVKLPCLRK
DFIYDTYQVAEARALGADCILIIMASVSDSQALELEAAASQWGMDVLVEVHSREELARAE
HLKSRLIGINNRNLDTFEVSLDVTRDLARRVPEDRLIVSESGLYTPDDLADLARYGARCF
LIGESLMRQQDVEAATRAILAAPLTSQGGI
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccattctcgaccgcatcaaggcttacaaactggaagagatcgaggcccgcaag
gccgaaaggccgctggtcgcggtcgaggatgcggcccgcgccgcgcctgcgccccgaggc
ttcgcccgggccctctcggcggccgccgcgaccggctacgggctgatcgccgagatcaag
aaggccagcccctcgaagggcctcatccgcgaggatttcgacgtgcccgcgctggcccgc
gcctatgaggcgggcggcgccacctgcctctcggtcctgaccgacggcccgtcgttccag
ggagcggacgagttcctgcgtcaggcccatgacgcggtcaagctgccctgcctgcgcaag
gacttcatctacgacacctatcaggtggcggaggcccgcgcgctcggggccgactgcatc
ctcatcatcatggcaagcgtcagcgacagccaggcgctcgaactcgaggcggcggcgagc
cagtggggcatggacgtgctggtcgaagttcattcgcgcgaggagcttgcgcgggcggaa
catctgaaatcgcggctcatcggcatcaacaaccgcaacctcgacacgttcgaggtctcg
cttgacgtgacgcgcgatctggcccgacgcgtgcccgaggaccggctgatcgtctccgag
agcgggctttacacgcccgacgacctcgccgacctcgcccgctacggcgcccgctgcttc
ctgatcggggaaagccttatgcggcaacaggatgtcgaggcggccacccgcgccatcctc
gcggcgccgctcacctcgcaaggcggcatctga

DBGET integrated database retrieval system