KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3149Help
Entry
Rsph17025_3149    CDS       T00512                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00010  Glycolysis / Gluconeogenesis
rsq00052  Galactose metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rsph17025_3149
   00052 Galactose metabolism
    Rsph17025_3149
Enzymes [BR:rsq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Rsph17025_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GerE Autoind_bind Sigma70_r4_2 Sigma70_r4 HTH_AsnC-type HTH_23 HTH_7 HTH_24
Motif
Other DBs
NCBI-ProteinID: ABP72033
JGI: Rsph170253149
UniProt: A4WXB9
Position
pRSPA01:complement(9600..10223)
Genome map
AA seq 207 aa AA seqDB search
MTLRSFSALTDQEPLFRDLAPAGSYVALRVGFLAPEEESNLFPSEWIRFYTTHAYGMKDP
LTRWAATANGATRWSSVTLPDEAGVMAAYRLHGLRYGCVIGLPARISRSRKRTFGIFARS
DREMTNAEIGALRASLAELHAPERDALTQSQAEVLRMLSEGVRYKEIAWRLGITEGAVKA
RFKAACQRLGARTAVQAANIAQKRGLL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacgctacgatccttctccgccttgaccgatcaggagccgctgttccgggaccttgcg
cccgcgggcagctatgtggcgctgcgggtgggctttctggcgcccgaggaagagtcgaac
ctgtttccatcggagtggatccgtttctacacgacccacgcctacggaatgaaggacccg
ctgacgcgatgggcggccaccgccaacggcgccacgcgctggagttcggtgaccctgcct
gacgaggcgggcgtgatggcggcctatcgcctccacgggctgcgctacggctgcgtgatc
ggcctgcccgcccgcatctcgcgcagccgcaagcgaaccttcggcatcttcgcccgcagc
gaccgcgagatgaccaacgccgagatcggcgcgctcagggcgagccttgcggaactccat
gcgcccgaacgcgatgccctcacgcaaagccaggccgaggtgctgcggatgctgagcgag
ggcgtccgatacaaggagatcgcctggcggctcggcatcacggaaggcgcggtcaaggcc
cgcttcaaggccgcctgccagcgcctcggcgcccgcaccgccgttcaggccgccaacatc
gcccagaagcgcgggcttctctga

DBGET integrated database retrieval system