KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3150Help
Entry
Rsph17025_3150    CDS       T00512                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rsq00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rsq00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRSPA01:complement(10409..11392)
Genome map
AA seq 327 aa AA seqDB search
MTITRFGTAPDGRAVQRITLQAGRLRVALLDLGAILQDVRLAGIDWPLTAGAPELAAYLG
PMRWFGAIVGPVANRIGGASARIGGRDVRFEPNEGPNLLHSGPQGLHGRLWQVVEVGSSR
ALLRLDLADGIDGFPGNRRIEAELTLTPPATLRLVLTAVSDAPTLMNLANHSYWTLDPEP
GIGGQHLRLAAEHWLPSADGLPTGEIRAAEGTFDLRAGRPLGPAEEIDHNFCLTHRPRTL
TEVARLTGRSGVSLTLATTAPGLQVYTGRDIDSGEHAGHHGRPLRAFDALALEPQLWPDA
PHHPAFPSIDLQPGALFRQETRFSFSA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcacacgcttcggcaccgcccccgacgggcgggccgtgcaacgcatcacgctt
caggccggccgcctgcgggtcgcactgctcgacctcggggccatcctgcaggacgtgcgc
cttgcggggatcgactggccgctgacggcgggtgccccggagcttgccgcctacctcggc
ccgatgcgctggttcggcgcgatcgtcgggccggtggccaatcgaatcggaggcgcctcg
gcccggatcggcgggcgcgacgtgaggttcgagccgaacgagggtccgaaccttctccac
tcgggtccgcagggccttcatggccgcctctggcaggtggtcgaagtcggatcgtcgcgc
gcgctcctccgcctcgatctggcggacggcatcgacggctttcccggcaaccggcggatc
gaggccgagttgaccctgacaccgccggccacgctccgactggtgctgacggctgtcagc
gacgcgccgacgctgatgaacctggccaaccacagctactggacgctggatcccgagccg
gggatcggtggccagcacctgcgccttgcggccgagcactggttgccgagcgccgacggc
ctgccgacgggcgagatccgggccgccgagggcaccttcgatctgcgcgcgggccggcca
ctcgggccagcggaagagatcgaccacaatttctgtctgacccacaggccgcgcaccctg
accgaggtggcccgcctcaccggccggtccggcgtcagcctgacgcttgccacgacggcg
ccggggctgcaggtctacaccgggcgtgacatcgacagcggtgaacatgccggccatcac
ggccgccccctccgcgcgttcgacgccctcgcgcttgagccgcagctctggcccgatgcc
ccgcaccacccggccttcccgtcgatcgaccttcagccgggggcgctcttccggcaggag
acccggttcagcttctcggcctga

DBGET integrated database retrieval system