KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3319Help
Entry
Rsph17025_3319    CDS       T00512                                 

Definition
(GenBank) Carbohydrate-binding and sugar hydrolysis
  KO
K00376  nitrous-oxide reductase [EC:1.7.2.4]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00910  Nitrogen metabolism
rsq01120  Microbial metabolism in diverse environments
Module
rsq_M00529  Denitrification, nitrate => nitrogen
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rsph17025_3319
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Rsph17025_3319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupredoxin_1 COX2 Cu-oxidase_3
Motif
Other DBs
NCBI-ProteinID: ABP72202
JGI: Rsph170253319
UniProt: A4WXT8
Position
pRSPA01:193055..194989
Genome map
AA seq 644 aa AA seqDB search
MSDKERGGISRRGLLGATAGGAALGALAPRAAMLAGGAGLATAAATGPAAAASKFALAPG
ELDEYYGFWSSGQTGEMRILGIPSMRELMRVPVFNRCSATGWGQTNESLKVMTENMTEKT
RKYLEANGKKVHDNGDLHHVHMSFTEGKYDGRYLFMNDKANTRVARVRCDVMKTDKILEI
PNAKGIHGLRPQKWPRTNYVFANGEDEAPMVNDGKVLDDPSQYVNFFTAIDADEMKVAWQ
VLVSGNLDNTDADYEGKYAFSTSYNSEMGTNLGEMMEAEMDHVVVFNIPEIEKGIAAGDF
QELNGVKVIDGRKGQNKNYTRYIPIANNPHGCNMAPDKIHLCINGKLSPTVTVIDVRKLD
AVFYEGAEPRSTVVAEPELGLGPLHTAFDGAGNCYTSLFLDSQVVKWNIDKAIRAYNGEK
VEPILQKLDVQYQPGHLKTSMGETLEADGKWLVVLCKFSKDRFLNVGPLKPENDQLVDIS
GDEMVLVHDGPTFAEPHDAIAVHASKMNIRSVWDRNDPTWADARAQAEKDGVNIDEFSGE
VIRDGNKVRVYLSGVAPSYSLEKFTVTEGDEVTVIVTNLDDVDDLTHGFTMGNHGVAMEV
GPMATASVTFVAGQPGVYWYYCQWFCHALHMEMRGRMFVEPKAA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaggaacggggaggcatcagccggcgcggcctgcttggcgccacggccgga
ggggctgcgctcggcgccctggcgccgcgggcggcgatgctggccggaggggcggggctt
gccaccgccgcggccacggggcccgcggcagccgcgtcgaagttcgcgctcgcgccgggc
gagctggacgaatattacggcttctggtcctcggggcagacgggcgagatgcgcatcctc
ggcatcccctcgatgcgcgagctgatgcgggtgccggtgttcaaccgctgctcggccacc
ggctggggacagaccaacgagtcgctcaaggtcatgaccgagaacatgaccgagaagacc
cgcaagtatctggaagcgaacggcaagaaggtccacgacaacggcgacctgcaccacgtc
cacatgtccttcaccgagggcaagtacgacggccgctacctcttcatgaacgacaaggcc
aacacgcgcgtggcgcgcgtgcgctgcgacgtgatgaagaccgacaagatcctcgagatc
ccgaacgccaagggcatccacggcctgcgtccgcagaaatggccgcgcaccaactatgtc
tttgccaatggcgaggacgaggcgccgatggtcaacgacggcaaggtgctcgacgacccg
tcgcaatatgtcaacttcttcaccgccatcgacgcggacgagatgaaggtggcctggcag
gtgctggtctcgggcaacctcgacaacaccgacgcggactacgaaggcaaatatgccttc
tcgacctcctacaactcggagatgggcaccaacctcggcgagatgatggaagccgagatg
gaccatgtcgtggtcttcaacatccccgagatcgagaagggcatcgcggccggcgacttc
caggagctgaacggcgtcaaggtgatcgacggccgcaagggccagaacaagaactacacc
cgctacatcccgatcgccaacaacccgcacggctgcaacatggcgccggacaagatccac
ctctgcatcaacggcaagctctcgcccacggtgacggtgatcgacgtccgcaagctcgat
gcggtgttctacgagggcgccgagccgcgctcgaccgtggtggccgagccggaactgggt
ctcgggccgctgcacaccgccttcgacggcgcgggcaactgctacacctcgctcttcctc
gacagccaggtggtcaagtggaacatcgacaaggccatccgcgcctacaacggcgagaag
gtcgagccgatcctccagaagctcgatgtgcaataccagccggggcacctcaagacctcg
atgggcgagacgctggaagccgacggcaagtggctcgtcgtgctctgcaagttctcgaag
gaccgcttcctgaacgtggggccgctgaagcccgagaacgatcagcttgtggacatctcg
ggcgatgagatggtgcttgtccatgacggcccgaccttcgccgagccccacgatgcgatc
gcggtccatgcctcgaagatgaacatccgctcggtctgggaccgcaacgaccccacctgg
gccgatgcgcgcgcgcaggccgagaaggatggcgtcaacatcgacgagttctcgggcgag
gtgatccgcgacggcaacaaggtccgggtctatctgtcgggcgtggcgccgagctacagc
ctcgagaagttcaccgtgaccgagggcgacgaggtgacggtgatcgtcaccaacctcgac
gacgtggacgacctgacccacggcttcaccatgggcaaccacggcgtcgcgatggaggtc
ggcccgatggccaccgcctcggtcaccttcgtcgcgggccagccgggggtctactggtat
tactgccagtggttctgccacgcgctccacatggagatgcgcggccggatgttcgtcgag
ccgaaggcggcctga

DBGET integrated database retrieval system