KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3350Help
Entry
Rsph17025_3350    CDS       T00512                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rsph17025_3350
Enzymes [BR:rsq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rsph17025_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRSPA01:complement(228715..229662)
Genome map
AA seq 315 aa AA seqDB search
MSATKPGRIAVVGSNMVDLVTYITRMPAPGETVEAPDFEIGPGGKGANQAVAAARLGSQV
AMVTKVGGDIFGENTRRNLAEQGIDTTHVGTVPGKSSGVAPIFVDPQGENSILIVKGANA
DLSPADVDAAEDTLRAADLVLMQMEVPRETVLHTVRRAAEWGVRTILNPAPAAADLNVDD
LRDLSFLVPNESELALLSGLPTGSEEEIEAAARSLIARGIGTVIVTLGGRGARLVTGEGV
VRIPAVRVTPVDTTGAGDAFIGAFAHFLAATGDVEGALTQAACYAAHSVTGRGTQKSYAT
AEVFADFCRSLPPSA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaacgaaacccggccgcatcgcggtcgtcggctccaacatggtcgatctggtg
acctacatcacgcggatgcccgcccccggcgagacggtcgaggcgcccgacttcgagatc
ggccccggcggcaagggcgccaatcaggcggtggcggcggcccggctcggctcgcaggtc
gccatggtgaccaaggtcggcggagacatcttcggtgagaacacccggcgcaacctggcc
gagcagggcatcgacacgacgcatgtgggcacggtgcccgggaaatcctcgggcgtggcg
ccgatcttcgtggatcctcagggcgagaactcgatcctgatcgtcaagggggcgaacgcc
gacctttcgcccgccgacgtggatgcggccgaagacacgctgcgcgcggccgacctggtc
ctgatgcagatggaggttccgcgcgagacggtgctccatacggtgcggcgggcggcggaa
tggggcgtgcgcaccatcctgaacccggcgccggccgcggccgatctcaacgtggacgac
ctgcgcgatctgagtttcctcgtcccgaacgagagcgagctggcgctgctctcgggcctg
cccaccggcagcgaggaagagatcgaggccgccgcgcgcagtctgatcgcccgcggcatc
ggcacggtgatcgtgacgctcggcggccgcggcgcgcggcttgtgaccggcgagggcgtg
gtgcggatcccggccgtccgcgtgaccccggtggacacgaccggcgccggagacgccttc
atcggcgccttcgcccatttcctcgcggccaccggcgatgtcgagggcgctctcacgcag
gcggcgtgctatgccgcccattccgtgaccgggcgcggcacccagaaatcctacgcgacg
gccgaggtcttcgcggacttctgccgctcgctccccccatccgcatga

DBGET integrated database retrieval system