KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3803Help
Entry
Rsph17025_3803    CDS       T00512                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rsq01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rsq00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRSPA01:701625..702749
Genome map
AA seq 374 aa AA seqDB search
MATLMPLQAPDIRNAKRLVVKIGSALLVDGEGLRRQWLSALALDVAEARTRGTQVILVSS
GSIALGRRVLHLPPGPLALEQSQAAAAVGQIRLARAYEEVLAPHGITTAQVLVTLEDTED
RRRYLNSRATMETLLALGAVPIVNENDTVATDEIRYGDNDRLAAQIAVTVGADQLVLLSD
VDGFYSANPKEDPAAERFDLVEAITPDLEAMAGDPISGVSKGGMKTKIMAAKTAVAGGCA
MAITEGSVMRPLKALETGAARTWFVAQGDPQVARKRWINAMKPRGTLKVDAGAVHALRAG
KSLLPAGVTAVEGNFGRGDPVEIAGPAGEVLGKGLTRYTAVEAVQIAGHRSAEIEGILGY
SGRAALVHRDDMVI
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaccctgatgccccttcaggcccccgatatccgcaacgcgaagcggctggtcgtc
aagatcggctcggcgcttctggtggacggcgagggtctgcgccgccagtggctctcggcg
ctggcgctggatgtggccgaggcgcggacgcgggggacgcaggtgatcctcgtctcctcg
ggctcgatcgcgctggggcggcgggtgctgcatctgccgccggggccgctcgcgctcgaa
cagagccaggccgccgccgccgtgggccagatccggcttgcccgcgcctacgaggaggtg
ctggccccgcacggcatcaccaccgcgcaggtgctggtgacgctggaggataccgaggac
cgccgccgctacctgaactcgcgcgccacgatggagacgctgctcgcgctcggcgccgtg
ccgatcgtgaacgagaacgacaccgtggcgacggacgagatccgatatggcgacaacgac
cggctggccgcgcagatcgccgtgacggtgggggcggaccagctggtgctgctgtcggac
gtggacggcttctattcggccaacccgaaggaagacccggcggccgagcgcttcgatctg
gtcgaggcgatcacgcccgacctcgaggcgatggcgggcgatccgatctcgggcgtctcg
aagggcggcatgaagaccaagatcatggcggcgaagaccgccgtcgcgggtggttgcgcg
atggcgattaccgaaggctcggtgatgcgcccgctgaaggcgctggaaacgggcgcggcg
cgaacctggttcgtcgcgcagggcgatcctcaggtggcgcgcaagcgctggatcaacgcg
atgaagccacgcggcacgctgaaggtcgatgcgggcgcggtgcacgcgctgcgcgccggc
aagtcgctgcttcccgccggcgtgacggcggtggagggcaacttcggccgcggcgatccg
gtggagattgcggggcctgcgggcgaggtactgggcaagggcctgacgcgctacacggcg
gtcgaggcggtgcagatcgcgggccaccgttcggccgagatcgagggcatcctcggctat
tcgggtcgcgcggcgctggtgcatcgcgacgacatggtgatctga

DBGET integrated database retrieval system