KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3887Help
Entry
Rsph17025_3887    CDS       T00512                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rsph17025_3887
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rsph17025_3887
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rsph17025_3887
Enzymes [BR:rsq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rsph17025_3887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRSPA01:785318..786550
Genome map
AA seq 410 aa AA seqDB search
MAEDGINSYMTGPDEQGRFGIFGGRFVSETLMPLILDLEARYEHAKTDPDFWAEMEDLWT
HYVGRPSPLYFAPRLTEHLGGAKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSIIGKEVRWQLAEQEGEGRLPDTV
VAAIGGGSNAMGLFYPFLDDPSVRIIGVEAGGKGVDDRMEHCASLTGGRPGVLHGNRTYL
LQDEDGQILEGFSISAGLDYPGIGPEHAWLHDTGRAEYVSITDAEALEAFQLCCALEGII
PALEPSHALAHVLKIAPNLPCDHIIVMNMCGRGDKDIFTVAKHLGFDMKI
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggacggcatcaacagctacatgaccggccccgacgagcagggtcgcttcggc
atcttcggcgggcgcttcgtctccgagacgctgatgccgctgatcctcgacctcgaggcg
cgctacgaacatgccaagaccgacccggatttctgggccgagatggaggatctctggacg
cactacgtcggccggccctcgccgctctatttcgcgccgcggctgaccgagcatctgggc
ggggcgaagatctacctcaagcgcgatgagctgaaccacaccggcgcgcacaagatcaac
aacgtgctgggccagatcatcctggcccgccgcatgggcaagacccggatcattgccgag
acgggcgcgggccagcacggcgtggcgacggccaccgtctgcgccaagttcggtctgaaa
tgcgtggtctacatgggcgcgcatgatgtcgagcggcaggcgccgaacgtgttccgcatg
cggctgctgggcgccgaggtggtgccggtgacgagcggccgcggcactctgaaggatgcg
atgaacgacgcgctgcgcgactgggtgaccaacgtccgcgacaccttctactgcatcggc
accgtggccggcccgcatccctatccggcaatggtgcgcgacttccagtcgatcatcggc
aaggaggtgcgctggcagctggccgagcaggagggcgagggccgcctgcccgacacggtc
gtggcggcaatcggcggtggctcgaacgcgatggggctcttctacccgttcctcgacgat
ccctccgtgcggatcatcggggtcgaggccggaggcaagggtgtcgatgaccggatggaa
cattgcgcctcgctgaccggcgggcggccgggcgtgctgcatggcaaccgcacctacctg
ctgcaggacgaggacggccagatcctcgagggcttttcgatctcggcgggcctcgactat
cccggaatcgggccggagcatgcctggctgcatgacacgggccgggccgaatatgtctcg
atcacggacgccgaggcgctggaggccttccagctctgctgcgcgctggaagggatcatt
ccggcgctggagccgtcacatgcgctggcccatgtcctcaagatcgcgccgaacctgccg
tgtgaccatatcatcgtgatgaacatgtgcgggcgcggcgacaaggacatcttcacggtg
gcgaagcatctcggcttcgacatgaagatctga

DBGET integrated database retrieval system