KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3955Help
Entry
Rsph17025_3955    CDS       T00512                                 

Definition
hypothetical protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rsph17025_3955
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rsph17025_3955
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rsph17025_3955
Lipid biosynthesis proteins [BR:rsq01004]
 Fatty acid synthase
  Component type
   Rsph17025_3955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRSPA01:complement(860664..861299)
Genome map
AA seq 211 aa AA seqDB search
MRNMSLALVFSAMPSLAAEDVTVLALGDSLTAGYGLPEGEGFVPQLQQWLRDHGQAVEVV
NAGVSGDTTAGGLARLDWSLTPEVDAMIVNLGGNDMLRGLDPGLSRSNLEAILKEARARE
LPVLLVGLEAPGNYGPDYKRDFDAIFPDLARSYEADLEANFFAPLTARLDEPDARQRYMQ
PDGIHPSTEGVAVIVEEIGPRVQALVERARN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacatgtcgctggcccttgtcttctcggccatgccgtcgctggccgccgaggac
gtcacggtgctggccctgggcgacagcctgaccgccggctacggactgccggaaggagag
ggcttcgttccgcagttgcagcaatggctgcgggaccacggccaggccgtcgaggtggtg
aatgcgggcgtctcgggcgacacgacggcgggggggctcgcacggctggactggagcctg
acccccgaggtcgatgccatgatcgtgaacctcggcggcaacgacatgctgcgcggactc
gaccccgggctcagccgctcgaaccttgaggcgatcctcaaggaggcccgggcgcgcgaa
ctgcccgtgctgctggtcgggctcgaggcgccgggcaactacggccccgactacaagcgc
gacttcgacgcgatcttcccggacctcgcccgcagctacgaggccgatctcgaggccaac
ttcttcgcgccgctgaccgcccgtctcgacgaacccgacgcgcgccagcgttacatgcag
cccgacggcatccatcccagcaccgagggcgtggcggtgatcgtcgaggagatcggcccc
agagtgcaggcgctggtcgaacgcgcgcggaactag

DBGET integrated database retrieval system