KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_4175Help
Entry
Rsph17025_4175    CDS       T00512                                 

Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rsph17025_4175
Enzymes [BR:rsq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Rsph17025_4175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pRSPA02:218694..219782
Genome map
AA seq 362 aa AA seqDB search
MKRRHFMASLLGTLAAGRAFGGFAQEGAAFVLPADHPLQPAWQAWKSLCLQEDGRIVDAP
QSGASHSEGQGYGLRLAVAFGDEEAFRRIFEWSESHLALREDGLLSWRYLPEAGDPVPDR
NNASDGDLFYGWALIQGAMAWNEPLFADRARMIGTALARSCLADHPDGSGRRYLLPAAYG
FTSDRAITLNLSYCMPRAMRELGAFAEAPALVTAAQDGLDLMNGIAGSGLLPDWLQLTPE
GRTPAPGLPDQSGYEALRIPLYLCWSGMTDTPAQQRFREMHRQAAARDRGTATVFDPETG
RIRESSDEVGYRALVALNDCVLSRTAGSAMPDFDAAQVYFPATLHLMALVAQAEFFPKCL
PV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaggcacttcatggcgtctctgctcggcaccctcgcggcaggacgggctttc
ggcggcttcgcacaggagggagccgccttcgtcctgcccgccgatcatccgctgcagccg
gcctggcaagcctggaaaagcctctgcctgcaggaggacggccggatcgtcgatgcgccc
caaagcggggccagccattccgaaggccagggttacggtctgcggctggccgtggccttc
ggggacgaggaggcgttccgcaggatcttcgaatggagcgaaagccatctggccctgcgc
gaggacgggctgctgagctggcgctacctgcccgaagccggcgatccggttcccgaccgc
aacaatgcctccgacggcgacctcttctacggctgggcgctgatccagggcgcgatggcc
tggaacgaacccctcttcgccgaccgggcccggatgatcggcacggcgctcgcgcgcagc
tgcctggccgatcatcccgacggctcgggtcgccggtatcttctgccggccgcctatggg
ttcaccagcgacagggccatcacgctcaacctgtcctactgcatgccccgcgcgatgcgc
gaactgggcgccttcgccgaagcccccgccctcgtcacggcggcgcaggacggtctcgac
ctgatgaacgggatcgccggatcaggccttctgcccgactggctgcagctgacgcccgag
gggcgcactcccgcgcccggcctgcccgaccagagcggctacgaggcgctgcgcattccg
ctctacctctgctggtcaggcatgaccgacacgcccgcccagcagcgcttccgcgagatg
caccgccaggccgcggcccgggatcggggcaccgccacggtcttcgatccggagaccggc
cggatccgggagagcagcgacgaggtcggctaccgggctctcgtggctctcaacgactgt
gtcctgtcacggaccgcaggatccgccatgccggatttcgacgccgcccaggtctatttc
cccgccacgctccatctgatggcgctggtcgcccaagccgagttcttccccaaatgcctg
cccgtctga

DBGET integrated database retrieval system